KEGG   Marinomonas mediterranea: Marme_1516Help
Entry
Marme_1516        CDS       T01449                                 

Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mme  Marinomonas mediterranea
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marme_1516
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Marme_1516
   00640 Propanoate metabolism
    Marme_1516
   00660 C5-Branched dibasic acid metabolism
    Marme_1516
Enzymes [BR:mme01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Marme_1516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1693653..1694819
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFADYGLPVSKGYAVDTPEEAVEAAKKIGGDKWVVKAQVHAGGRGKAGGV
KLVDSHEEVSAFAANWLGKNLVTYQTDENGQPVAKILVESCTDIANELYLGAVVDRSTRK
VVFMASTEGGVEIEKVAEETPELIHKAIIDPLVGAQPYQAREMAFKMGLSPEQTKQFTKI
FLGLSQMFHDFDFALLEINPLVITDEGNLHCLDGKINIDSNAVYRQKKMQEFHDPSQEDE
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVEQVGVTVPVVVRLEGTNAEKGREV
LANSDLDIIAATSLKDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacatgaatatcaagctaaacagctttttgctgattatggcttgccagtgtca
aaagggtacgcagtagatacgccagaagaggcggtagaagctgcaaagaaaattggtggt
gataagtgggttgtaaaagctcaagttcacgccggcggccgtggtaaagctggtggtgta
aaacttgttgattctcacgaagaagtatcagcattcgctgctaactggttaggtaagaac
cttgttacttatcaaactgacgaaaatggtcagccagttgcgaaaattcttgttgagtct
tgcacagacatcgcaaacgaactatacctaggtgctgttgtagaccgttcaactcgtaaa
gttgtcttcatggcgtctacagaaggtggtgtagaaatcgagaaagttgctgaagaaact
cctgagttgatccacaaagcaatcatcgaccctctagtaggtgcacaaccttaccaagct
cgtgaaatggcattcaaaatgggcttaagcccagagcaaactaagcagttcactaagatc
ttcttaggtttgtctcaaatgttccacgacttcgatttcgcacttttagaaatcaacccg
cttgtaatcactgatgaaggtaaccttcattgcctagacggtaagatcaacatcgacagc
aacgctgtataccgtcagaagaaaatgcaagagttccacgatccgtctcaagaagatgag
cgtgaagcgcatgcagcacagtgggaattaaactacgtagctctagacggtaacgttggt
tgtatggttaacggtgcaggtctagcgatgggtacaatggacatcgtaaatctacacggc
ggtaagccagctaacttcctagacgtaggtggtggcgcgactaaagagcgtgttgctgaa
gcattcaaaatcatcttgtctgatgacaatgttaaagccgtacttgttaacatcttcggt
ggcatcgtacgttgtgacatgatcgctgaaggtatcatcggtgcagttgagcaggttggt
gtaaccgttcctgttgttgttcgcctagaaggtacgaacgctgagaaaggtcgtgaagtt
ctagcgaactctgatcttgatatcatcgctgctacaagtttgaaagacgcagctgagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system