KEGG   Marinomonas mediterranea: Marme_1597Help
Entry
Marme_1597        CDS       T01449                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
mme  Marinomonas mediterranea
Brite
Enzymes [BR:mme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     Marme_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1783523..1784305
Genome map
AA seq 260 aa AA seqDB search
MHTPKTFWIGTSWKMNKTSAEALDFSTALLDSPSDDRIQRFVIPPFPYIHLVKSQLSQSS
VKVGAQNMHWESSGAWTGEVSPLMLKDAQLDLVELGHSERREFFGETDEFVGRKVASAIE
HGLIPLICIGEPLDVKESGRASEYLAKQIEGAFQFLSEQARNAPMLIAYEPIWAIGEQGT
SASPSYANARHQEIKAHAHHLLKREVACLYGGSVNAQNCKELAACEHIDGLFIGRAAWEV
DGFKHIINACTQVIHSNKNN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcacacgcctaaaaccttctggattggcaccagctggaaaatgaataagacttccgct
gaagcgttggatttttcgacagcgctgcttgatagtccgagtgacgatcgcattcagcgt
tttgtcattcctccgtttccttatatccatttagtaaaaagccagcttagccagagttcg
gtgaaagtcggcgctcaaaatatgcattgggaatccagcggtgcgtggacgggcgaagtc
tcgccactcatgcttaaagacgcacaattggatctggttgagctggggcattctgaacga
agagagttctttggtgaaacggatgaattcgtcggtcgcaaagtagcctccgccatagag
cacggcttaatccccctcatctgtatcggagaaccattagacgtaaaagagagtggtcgc
gccagtgaatatttagcgaagcagattgaaggggcgtttcagttcttatccgaacaagcg
cgtaatgcacctatgttaatcgcttacgaacctatctgggcgattggagaacagggtacg
tcggcgtcgccaagctatgcgaatgccagacatcaagaaataaaggctcacgctcaccac
cttttaaagcgcgaagtggcttgtctctacggtggttctgtaaatgctcaaaactgcaaa
gagctcgcagcctgcgaacacatagacggcctttttattggccgtgcggcgtgggaggta
gacggttttaaacacatcattaatgcctgtacacaagttattcattccaacaaaaacaat
taa

DBGET integrated database retrieval system