KEGG   Marinomonas mediterranea: Marme_1618Help
Entry
Marme_1618        CDS       T01449                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mme  Marinomonas mediterranea
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mme00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1805417..1806898
Genome map
AA seq 493 aa AA seqDB search
MRKVILAIDEGTTNVKSLLMDKQGDVIGKGSSPLSINYPSAGLVEQDPLEMIERVKASIE
LALKSTAEKVDIEAVAISNQRESVLLWDRQTGKPLSNVISWQCRRSESLCESLREDEIFS
QYVQSATGLTLDPMFPATKVSMVLSQISMGEERAEKGEICIGTINSWLIWNMTDQTFVTD
VSNASRTQLFNIRNLVWDAEILKKLHIPVKALPAVVGSSCVVGVTREFGMLKGDIPIASQ
VGDSHAALFGHGGFNKGVVKATYGTGSSVMAAMPKLPAIRSEISTTIAWQDSDLFYGLEG
NITHTGSGIDWVRRMLGVEDIEAMCELAAEADKDHSVFFVPALSGLGAPYWDLDATGIFS
GLKSGTERADIARAAFEAVIFQVADVFNVIQEELPAPIEYLSVDGGPTLNDWLMQAQADL
LGVTIRRGDVAEVSAMGAGFLAGLEIGWWGDKEALASLKRHEVLFDPKQAKHEYWQTRYL
SWKAAVLKCRMPS
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaggtcattttggcaatagatgaaggtacaacgaatgttaagtccttacttatg
gataagcagggtgatgtgattggtaagggttcttcccctttatctattaattacccttct
gcggggcttgttgagcaagatccgcttgaaatgatcgaaagagtgaaagcatcaattgaa
cttgcgttgaaatccaccgctgagaaagtggatatagaagccgttgctattagcaatcag
cgtgagtctgttctcttgtgggatcgccaaacagggaagccgctatctaatgtgatcagt
tggcaatgtcgtcgttctgaatctttatgtgagtcattacgcgaagatgagatttttagt
cagtatgttcaatccgcaacgggattgacgttggatcctatgtttcccgcgaccaaggta
tccatggttttaagtcaaatttcgatgggcgaagaacgagcagaaaaaggtgagatatgc
atcggtacgattaacagttggctgatttggaatatgaccgatcaaacatttgttacggat
gtttctaatgcgtctcgtactcagcttttcaatattcgaaacctcgtctgggacgcagaa
attctgaagaaactgcatattcctgtaaaagcattgcccgcagttgttgggtcttcatgt
gtggttggagtaactcgtgaattcggtatgttaaagggcgacattcctatcgcgtcgcaa
gtgggagattctcatgctgctcttttcggccacggcggttttaataaaggcgttgtaaaa
gcaacctatggcaccggtagctctgtgatggctgcgatgccgaagcttcctgcgattcgt
agtgaaattagtacaacgattgcatggcaagacagtgacctattttatgggcttgaaggc
aacattacgcatactgggtcgggcattgattgggttcgacgcatgttgggtgtggaagac
attgaagctatgtgtgagcttgctgcagaagcagataaagatcactctgtgttttttgtc
ccagcgttatctggactcggtgcgccgtattgggatttagatgcaacgggaatttttagc
ggtctaaaaagtggaaccgagcgagcggacattgctcgcgctgcatttgaagccgtgatt
tttcaggtggccgatgtattcaatgtgatacaagaagaattacctgcgccgatagagtat
ctcagtgtagacggaggtcccacacttaatgactggttgatgcaagctcaagcggattta
ctgggagtgacaataagacgaggcgatgttgctgaagtgtcggcgatgggagcgggcttt
ttggccggcttagaaataggttggtggggtgataaagaagcattagccagtcttaaacgt
catgaagtattgtttgacccaaaacaagcgaagcatgaatactggcaaacgcgttatctt
agttggaaggctgccgtgctgaaatgcaggatgccttcgtaa

DBGET integrated database retrieval system