KEGG   Marinomonas mediterranea: Marme_2073Help
Entry
Marme_2073        CDS       T01449                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mme  Marinomonas mediterranea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marme_2073
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marme_2073
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Marme_2073
Enzymes [BR:mme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Marme_2073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2270805..2272016
Genome map
AA seq 403 aa AA seqDB search
MSDNKFNSDLPDERGRFGRFGGVFVSETLMSALDDLTNMYQELSKSAEFQAAFDNDLAHY
VGRPSPLYFAERLTEQAGGAKIYLKREDLNHTGAHKINNAIGQALLAKHMGKPNIIAETG
AGQHGVATATVAARLGLNCKVFMGEEDIRRQTLNVYRMKLLGAEVIPVDSGTKTLKDALN
EAMRYWVSNVDDTFYIIGTAAGPHPYPMLVRDFQAIIGRETKEQSLAREGRLPDAVVACV
GGGSNAIGMFHPFINDTEVRMYGVEPGGYGLETGQHAAPLSAGRPGVLHGNRTYVMADDD
GQILGTHSISAGLDYPGVGPEHAWLKDSGRADYVVIDDDEAMDGFRTLTKIEGIMPALES
SHAVAYGMKLAKTMSKDQFIVVNISGRGDKDIHTVASLDGVEV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgataacaaatttaattcagatttgccggatgaaaggggccgatttggacgtttt
ggtggagtgtttgtttctgagacgttaatgtcggcacttgatgacctgactaacatgtat
caagaattgtctaagagtgcagaatttcaagctgccttcgataatgatcttgctcactat
gttggtcgtccttcgcctttgtatttcgccgagcgtctaactgaacaggcgggcggagcg
aaaatctatcttaaacgagaagatctaaatcataccggcgcgcataaaattaacaatgcg
attggtcaggcgctgctcgctaagcatatgggtaaacctaatattattgctgagactgga
gcggggcagcatggcgttgcgactgcgacggttgccgcaagacttggtttaaattgtaag
gtgtttatgggagaagaggacattcgacgccagacactaaacgtgtatcgaatgaagctt
cttggtgctgaggttattcctgtagattcaggtactaaaacgttaaaagatgcgctgaat
gaagcgatgcgttattgggtaagtaatgttgacgatactttctacattataggtactgct
gccggcccgcacccttatccgatgttggtacgagactttcaagcgatcattgggcgagaa
acaaaagaacagagtctcgcgcgcgaaggtcgtttaccggacgcagttgtagcatgtgtt
ggcggtgggtctaatgcaataggaatgtttcatccgttcattaatgataccgaagtccgt
atgtatggtgttgaaccaggtgggtatgggttggaaacagggcagcatgctgcgccattg
tcagcggggcgaccaggtgttttacatggtaatcgtacctacgttatggccgatgatgat
ggacaaatcttgggtacgcactccatatctgcgggtcttgattaccctggagtggggcca
gagcatgcttggttgaaagacagtggtcgagctgattatgttgttatcgatgacgatgaa
gcaatggatggttttcgtacgctgacaaagatcgagggcattatgcctgctttagaatct
agtcacgccgttgcttacggtatgaaacttgcgaagacaatgtctaaagatcagtttatt
gttgtgaatatatcaggtcgtggtgacaaagatatacatactgtcgcttcattagatggt
gtagaggtctaa

DBGET integrated database retrieval system