KEGG   Marinomonas mediterranea: Marme_2136Help
Entry
Marme_2136        CDS       T01449                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  diguanylate cyclase [EC:2.7.7.65]
Organism
mme  Marinomonas mediterranea
Brite
Enzymes [BR:mme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Marme_2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF DUF4349 DUF3568 DUF1978 Sec20 APG6 DUF4803 Laminin_II Phasin T3SSipB DUF4618
Motif
Other DBs
NCBI-ProteinID: ADZ91379
JGI: Marme_2136
UniProt: F2K437
Position
complement(2343620..2344624)
Genome map
AA seq 334 aa AA seqDB search
MQDEGLKEANEILRKAVPLMQRLNIAPTPYNYGVCYEYSSNRTPKLNKLMDATIRTLGGV
PDYLTKELFHQFVIDDSQFNNEHQDKIEALIEASQKGSKEMQSSLDELDDVLKKSKRVLD
RADRQKHVEKVLTYLEKGTQKAIQSTVKFNESLNVVRYEIDALKSEIEALKNNVELDPLT
QHYNQKGLERYMYTWKQGAEDDLSLMLIDIDRLQGIIKQHGRRAGTSLIRYLGKLIKDAN
VQNSVLARVEGGTYALLVNELELSQATGLAEQLREKMSLQKIRYKDTKKEMTRLTVSIGV
ATLIGDESVSSLLARTRVYLENAKHRGRNRISSN
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacgaaggtcttaaagaagcgaatgaaatattgcgtaaggctgtcccccttatg
cagcgactgaacatcgcccctacaccctacaactatggtgtgtgttacgagtattcctct
aatcgcactcccaagctaaacaaactaatggatgcgaccattagaacgcttggcggtgtg
cctgattacttaaccaaagaactttttcaccagtttgtaattgatgactcacagtttaac
aacgagcatcaagacaaaattgaagcgcttattgaagcgtctcaaaaaggctccaaagaa
atgcaaagctccctcgatgagctagatgacgtacttaaaaaaagtaaacgtgtattggat
cgagccgatcgccaaaagcacgttgaaaaggtgttgacctatttagaaaaaggcacccaa
aaagcgattcaaagcactgttaagtttaacgaaagtctcaacgtcgtacgctatgaaata
gacgcattaaagagcgaaattgaagcccttaaaaataatgtcgagttagacccgctcact
cagcattataatcaaaagggacttgaacgttacatgtacacttggaaacaaggcgcagaa
gacgatttgtcactaatgctcattgacatagatcgacttcaagggattattaaacagcat
ggtcgacgtgcaggaacgtctttaattcgttatctcggcaaactgataaaagacgctaac
gtacaaaacagtgtgttggcgcgcgtagagggtggtacctacgccctattggttaacgaa
ctggaactgtcacaagcgacaggattagcagagcaattgcgcgaaaaaatgtcgttgcaa
aagattcgctataaagacaccaagaaagaaatgacgcgactcacggtttccatcggcgtt
gccaccttaatcggtgatgagagcgtatctagtttgctagcccgtacgcgagtgtatttg
gaaaacgcaaaacaccgaggccgaaatcggatctcttcgaattag

DBGET integrated database retrieval system