KEGG   Marinomonas mediterranea: Marme_2347Help
Entry
Marme_2347        CDS       T01449                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mme  Marinomonas mediterranea
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mme03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2581737..2582330)
Genome map
AA seq 197 aa AA seqDB search
MFSPLIKELMESLRCLPGVGPKSAQKMALYLLERDSQGADRLANALRDALDKVGRCATCR
TLTEDTECSICLDQARDGTRLCIVETPADVIAMENAGSFDGRYFVLLGHLSPIDGIGPEE
LGLDRLENLVRNTDVEEVIIATNSTIEGEATSHYISELLKPLNIELSRLAQGVPMGGELE
YVDGNTLALALKGRKKL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagtcctcttatcaaagaactgatggaatcgcttaggtgcctacccggagtaggc
cctaaatctgctcaaaaaatggcgctctatttgttagagcgcgacagtcaaggagcagat
agattagccaatgcacttcgcgacgcgctggacaaagtcgggcgctgcgcaacctgtcga
acattgaccgaagatacagaatgctctatctgtctggatcaagcacgcgatggcactagg
ttgtgtattgtcgaaacgccagcagatgttatcgcaatggaaaatgctggctcattcgat
ggtcgatattttgttttattaggtcacttgtctccaatagatgggatagggcctgaagag
cttggtttagatcgactggaaaatttagtccgtaacacggacgttgaggaagtcattata
gcgacgaactcaacaatagaaggtgaagcaacgagccactacatctctgagttgctgaaa
ccattaaatattgaactaagccgccttgctcagggagtgccaatgggtggtgagctggaa
tatgtcgatggcaatacattggcactggcgttgaaagggcgaaagaaactttag

DBGET integrated database retrieval system