KEGG   Marinomonas mediterranea: Marme_2483Help
Entry
Marme_2483        CDS       T01449                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mme  Marinomonas mediterranea
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Marme_2483
Enzymes [BR:mme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Marme_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2744945..2746699
Genome map
AA seq 584 aa AA seqDB search
MDSSAPSHLEQRLTGHLQTLYPKLDASELARNCLTTFHLDANSEPPRPHKNLWDQSDIML
ITYADTLRSEESTPLETLHKFVKNNLSESISAVHLLPFFPYSSDDGFSVMDYTTVNPSSG
DWTNISNITKDFKVMGDLVINHCSSRSMWFENYKAGVSPGAEYFYETAPQSDLSNVVRPR
TSPLLREVQTKNGIKHVWCTFSHDQIDLNFENPEVLLEFLRIIRLYLEKGIRWFRLDAVA
FLWKTPGTNCINLPNTHEMIRLLRLMIEHWAPDSVIITETNIPNRENLTYFGNANEAHLI
YNFSLPPLLINTLVTGNCSHLKSWLMGMPPAQQGTTYLNFVASHDGIGLRPTEGLLSEWE
IDTLIGTMKKFGGKVSSRTTPEGEAKPYEINISLWNALSGSVLHGPDQWQFARFLCAAGV
QMALEGVPAFYIHSLFGTENDHERVSNTGQFRSINRHIWQMEELEHALNTNTHHKKVFEA
MSRLMKIRRAQAAFHPNATQYVLHMGDELFAFWRQSIDRRQSLFAVYNISDQPQTFNLSE
LNLIATEDWTDLVSDQRYEDQMAQVTLMPYQFMWLANKTTRPKD
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggactcaagcgctccttcacacttagaacaacgccttacggggcatttgcaaacgctt
tacccaaaactcgacgctagtgaacttgcgagaaactgtctaacgacattccatttagac
gcaaattcggagcctccgagaccgcataagaacttatgggatcaatcggacatcatgttg
attacctatgcggatacactgcgctcagaagagtccacgccgctagagacgctacataag
ttcgtaaagaacaatcttagtgaaagcatttcagccgtacatcttcttcctttcttccct
tacagttcagatgacggctttagtgtcatggattatacgacggtcaacccttcaagcggt
gactggacgaacatctcaaacatcacgaaagatttcaaagtaatgggagaccttgttatt
aaccactgctccagtcgaagtatgtggtttgaaaactacaaagcaggagtttcgccgggt
gccgaatacttttatgagacagcccctcaatcagacctgagcaatgttgttcgccctcgc
acttcccccctattgcgtgaagtccaaacaaaaaacggtataaaacatgtctggtgtacc
tttagccatgatcagatcgacttaaactttgagaacccagaagtactgttagagtttctc
agaatcattcgactttatttagaaaaaggcattcgatggtttaggctagacgccgtcgcc
tttctttggaaaacaccgggcaccaattgcataaacttacccaacacccatgaaatgatt
cgacttctacgactgatgatcgaacattgggcaccagattcggtcattatcactgaaaca
aacattcccaacagagagaaccttacgtatttcggtaatgctaacgaagctcaccttatc
tacaacttctctttaccaccactcctgatcaataccttagtgactggcaactgctcgcac
ctaaaaagctggcttatgggcatgccgcctgctcaacaaggtacaacttatctgaacttt
gttgcatcgcacgacggcattggtttgcgaccaactgagggattgctatcagaatgggaa
atcgacacgctgattggcacaatgaaaaagtttggtggcaaagtcagctcccgaactacc
ccagaaggcgaggcgaagccgtatgaaataaatataagcctctggaatgcgcttagcggc
tctgttttacatgggccagaccaatggcaatttgcgcgttttttgtgtgctgcaggcgtt
caaatggctctcgaaggtgtacccgccttttacatccattcgctatttggaacagaaaac
gatcacgaaagggtcagtaacacgggacaatttcgctctattaatcgtcacatttggcag
atggaggaattggaacacgctttaaatactaatacgcatcacaaaaaagtgtttgaagcg
atgagccgcttaatgaaaattcgccgagcacaagcggcattccacccaaatgcgacacaa
tacgtattgcatatgggtgatgaactgttcgcgttttggcgtcagagtatagacagacga
caaagtctatttgccgtttacaatatttccgatcagccccaaaccttcaatttatccgaa
ctaaacctgatagcaaccgaggattggacagatcttgtgagcgatcaacgctatgaagac
caaatggcacaagtcacgctcatgccatatcaatttatgtggctagcaaataaaacgacg
cgacccaaagattaa

DBGET integrated database retrieval system