KEGG   Marinomonas mediterranea: Marme_2696Help
Entry
Marme_2696        CDS       T01449                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
mme  Marinomonas mediterranea
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Marme_2696
Enzymes [BR:mme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Marme_2696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2968735..2969691)
Genome map
AA seq 318 aa AA seqDB search
MSIEKPLHQPQSGNDMPRFGGRATMMRLPFVEQLEELDAAFIGIPLDIGTSQRAGTRYGP
RQIRAESVMIRPYNMATGAAPFDSLSVGDIGDVPINTYNLLKSVEIIEDYYTQLNQYPLV
PLTLGGDHTLTLPILRAIKKKHGPVALIHVDAHTDTNDNMFGEKIAHGTTFRRAVEEGLL
DCDHVFQIGQRAQGYSAEDFKWGENQGFQLITAEQCWHKSLDPLMHEIRQKIGDRPVYLS
FDIDGIDPAWAPGTGTPEVGGLTSIQGLEIVRGCKGLNLVGGDLVEVSPPYDVSGNTSQL
AANYLYEMLCVLPGVTYR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtccatagaaaagccattacatcagccgcaaagtgggaatgatatgccgcgctttggt
ggccgagccactatgatgaggttgccttttgtagagcaattggaagagttagatgctgcg
ttcattgggatcccattagacatcggcacgtcgcaacgtgcgggtactcgttatggtcct
cgtcaaattcgagccgaatccgtcatgattcgcccttataatatggcaacaggtgcagct
ccttttgactcgttgagtgtcggcgatatcggcgatgttcctatcaatacttataatcta
ttaaaatcagttgaaatcattgaagattactatactcaactaaatcaatatcccttggtt
cctttaaccctcggtggtgaccacacgttaacactgccaattctaagagcgatcaaaaaa
aagcatggcccagtggctttgattcatgtcgatgcacataccgataccaacgacaatatg
tttggcgaaaaaatagcccacggcacaacatttagacgcgctgttgaagaagggctattg
gattgtgaccatgtttttcaaatagggcaacgtgcgcaaggctattccgcagaagacttt
aagtggggtgaaaaccaaggttttcagctcatcacagctgaacaatgttggcataaatct
ttagaccctctaatgcatgaaataaggcaaaaaataggtgataggccagtttatctttct
tttgatatcgatggcattgatcctgcttgggctccgggtaccgggacacctgaagtgggt
ggactaacctcgatccaaggccttgagatagtgcgaggctgtaaaggcttaaaccttgtc
ggaggtgatctggtagaagtatcgccaccctatgatgtcagtggcaacacgtctcagctg
gcggctaattatctttatgaaatgttatgtgtcttaccgggtgtgacctaccgataa

DBGET integrated database retrieval system