KEGG   Marinomonas mediterranea: Marme_2799Help
Entry
Marme_2799        CDS       T01449                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mme  Marinomonas mediterranea
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mme00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Marme_2799
Enzymes [BR:mme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Marme_2799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3063225..3065243)
Genome map
AA seq 672 aa AA seqDB search
MDFSNSSVESDTKWFDAWLSSKSIRPVDLQWIHHLQDHVSSQDESVLLAGVLVSAYLGAG
HTCIDLTAVFNGDLAGLEFHPAPSVVLSALDIHSVGAWYRRLSDSPLVALFDGASSHSAS
SASFSLASSAPLILTDAGLLYLARYFSYEQSVLSFIQLQESKGRRQVDGQKLDSLFPSDV
QSSELDWQKIAVANAASMDFSIISGGPGTGKTTTVTKLLALLVWQSLDEAANEERDHLTN
EFRESDARLLSNALHKSSLPRIALAAPTGKAAARLTESISGAKKKLNIAQPILDAIPETA
TTLHRLLGADYGRSQFKHHKQNPLHIDILLVDEVSMVDMPMMAKLIEALPEHARLVLLGD
KDQLSSVEAGNVLGDLTFGIQREKVTRAQFTGLTDSLNAAELERLSRQVIEQAPAIQRHL
SLLSKSYRFNDQSGIGLLASAVNQCQVDGTLRVLRGDYDNVYWRSTDLKETQLDVAALAQ
GYKTYWAQVRQRVAPAELHTAFNQYQVLTAVRQGVMGVEFVNDALETYFYRQGYIESQSM
WYPGKAIIMTRNDSNTGLFNGDIGLCLPDEQNVLRVWFTLANGEMKGFLPSRITSFEPVF
AMTVHKSQGSEFERVTMILPNNASPVLGKELIYTGITRAKHYFELWANEFILQDALKKRV
QRRSGLTKAIWR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
ttggacttctctaattcaagtgttgagtcagacacaaaatggtttgatgcttggttgtct
tccaagtccattcgtcctgttgatttacagtggattcatcaccttcaggatcatgtttca
tcgcaagacgaatctgtcttgcttgcgggcgtgttggtcagcgcctatcttggggcggga
cacacttgcatcgacctaacggcggttttcaatggtgatttagccgggttagagttccat
ccggctccaagtgttgtcctgtcagcgcttgatattcatagcgtaggtgcgtggtatcgt
cgcttgagcgacagtccactggtcgccttgtttgatggtgcgtcgtctcattctgcttct
agcgcttctttttctttagctagctctgcgcctttgatactgactgatgctggtcttttg
tatctggcgcgttacttttcttatgaacagagtgttctgtcttttatccaattgcaagag
tcgaagggtcgaaggcaagtggacgggcagaaactagactctttgtttcccagtgatgtt
caaagcagtgagttagattggcagaagatcgccgttgcgaacgccgcgagtatggatttc
tctatcatcagtggtgggccgggtacgggtaaaacaacaacggttactaaactgttggcg
ttgcttgtttggcagtctcttgatgaagcggctaacgaagagcgagaccatttaacaaac
gaattccgagaaagcgatgctcgcttgctctccaacgctctacataaaagctcgctgcct
cgaattgctctagccgcgccgaccggaaaggctgctgcacgtttgactgaatccatctct
ggcgcgaagaaaaaactcaatattgcccaacccattctggatgcgataccagagaccgcc
accactttacatcgtcttttaggggcggattatgggcgctctcaatttaaacaccacaaa
caaaacccgcttcacatcgatatattgctggtggatgaagtctcgatggtggacatgcca
atgatggcaaaattaattgaagccttgccagagcatgcaaggttggtgttactcggcgat
aaagatcaactttcttcagtcgaggctggaaatgttttaggggacctgacctttggcatt
cagcgcgagaaagtaacacgggcgcaatttacagggttaacggactcattgaacgcagcg
gagctggagcgtttgtcccgccaagtgatcgaacaagcgcctgcgattcagcgtcattta
tcactcttgagtaagagttatcgctttaatgaccaaagtggcattgggttattggcgtct
gcggtcaatcaatgtcaggttgatggcacactaagagtgcttcgcggcgactacgataac
gtgtattggcgttcgacagatcttaaagagactcaactggatgttgcagccttggcgcag
ggctacaaaacctattgggctcaagtcagacagcgtgtggcgccggcagagctgcatacc
gcgtttaatcaatatcaggtgctgacggcggtgcgccaaggggtaatgggcgtggaattc
gttaacgatgcactggaaacgtatttctaccgacaaggttatatagaatcccaatccatg
tggtatccgggcaaagccatcataatgacgcgaaatgattcaaacacagggctttttaac
ggcgatattgggctgtgcttgccagatgaacagaatgtcttacgggtttggtttactctc
gccaacggtgaaatgaaaggctttttaccaagccgcattaccagctttgagccggttttc
gccatgacggtgcacaaatctcaaggctccgagtttgagcgtgtgaccatgatcctgcca
aacaatgcgtcccctgttttaggcaaagagcttatttacacgggaatcacacgggcaaaa
cactatttcgagctatgggcgaacgagtttattcttcaagatgcgttgaaaaaacgcgtc
caacgtcgctctggtttaacgaaagcgatctggcgttaa

DBGET integrated database retrieval system