KEGG   Marinomonas mediterranea: Marme_2885Help
Entry
Marme_2885        CDS       T01449                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mme  Marinomonas mediterranea
Pathway
mme00260  Glycine, serine and threonine metabolism
mme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01130  Biosynthesis of antibiotics
mme01230  Biosynthesis of amino acids
Module
mme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marme_2885
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Marme_2885
Enzymes [BR:mme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Marme_2885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADZ92107
JGI: Marme_2885
UniProt: F2JZZ5
Position
3160419..3161684
Genome map
AA seq 421 aa AA seqDB search
MQSDNGYYGEFGGSYIPEILYSSQQQILNAYEEAKNDPAFIAELKQQWQEYSGRPTPLTF
CKNLTEHFGGAQIYLKREDLNHSGAHKMNNVIGQGLLVKRMGKKRVIAETGAGQHGIATA
LVCARLGLECTIYMGAKDVKRQYPNVFWMEQLGATVVPVTEGSQTLRDALDEALRDWSST
HEDSHYLIGTTCGCAPFPEMVAFFQSVIGEEVKEQSKAQFGRYPDKLYACVGGGSNACGL
FLPFVDDKDVEMVGVEAGGKGTKLGEHSIRLSHNLGTPGIAQGFASIFIQDDAGQLQETH
SISAGLDYVGVSPIIAHLAKEGRINMTYAMDDEVVDACTLLLKNEGIIPALESSHALAGA
FKDAPSMSKDTHIVINLSGRGDKDIFNVAKALQDPTFPNFLNDYLEDYEKDTLIKKTEKE
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcgataatggttactacggtgagtttggtggaagctacattccagaaatactc
tactccagccaacaacaaattctgaacgcttacgaagaagcgaagaatgaccctgccttt
atcgccgagctaaaacaacaatggcaagaatactcaggtcgccctacgccacttacattc
tgtaagaatttaacagaacattttggtggtgcgcagatttacttaaaacgtgaagattta
aaccattctggcgcgcacaaaatgaacaatgtgattggccaagggttgcttgttaaacgc
atgggtaaaaaacgcgtcatagctgaaacaggcgctgggcaacacggtatcgcaaccgcc
ctcgtttgtgctcgcttgggattagaatgcaccatttatatgggcgcaaaagatgtaaaa
cgccaatacccaaatgtcttctggatggagcaattaggtgcgactgttgtccctgtaaca
gaaggttctcaaacactaagagacgcattagacgaagcattacgagactggtcttcgaca
cacgaagacagccattacctaatagggacaacctgtggctgtgctcctttccctgaaatg
gtggccttctttcagtctgtcatcggcgaagaggtcaaagagcaaagtaaggctcagttt
ggtcgatacccagataaactctacgcttgtgtcggtggcggctctaacgcttgcggactg
ttccttccatttgtagacgacaaagacgtcgaaatggtgggtgtcgaagcaggcggtaaa
ggcacaaagctgggcgagcactctattcgtttgtcccataatttaggcacaccggggatt
gcccaaggttttgccagcatctttattcaggatgatgcggggcaacttcaagaaacccat
tctatttccgccggtttagattacgttggtgtctctcctattatcgcgcacttggcgaaa
gaaggccgcatcaatatgacctacgctatggacgatgaagtggtcgatgcctgcacgtta
cttttgaaaaatgaaggcattatccctgcacttgaatcctctcacgcattagcaggcgcc
tttaaagatgcgccttcgatgtcgaaagacactcacatcgtcattaacttgtctggtcgt
ggtgataaagacattttcaacgtcgcaaaagcactgcaagaccctacgttccctaacttc
ttaaacgactacttagaagactacgaaaaagatacgttgattaaaaaaacagaaaaggag
gcatag

DBGET integrated database retrieval system