KEGG   Marinomonas mediterranea: Marme_2885Help
Entry
Marme_2885        CDS       T01449                                 

Definition
tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mme  Marinomonas mediterranea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mme01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mme00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mme00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3160419..3161684
Genome map
AA seq 421 aa AA seqDB search
MQSDNGYYGEFGGSYIPEILYSSQQQILNAYEEAKNDPAFIAELKQQWQEYSGRPTPLTF
CKNLTEHFGGAQIYLKREDLNHSGAHKMNNVIGQGLLVKRMGKKRVIAETGAGQHGIATA
LVCARLGLECTIYMGAKDVKRQYPNVFWMEQLGATVVPVTEGSQTLRDALDEALRDWSST
HEDSHYLIGTTCGCAPFPEMVAFFQSVIGEEVKEQSKAQFGRYPDKLYACVGGGSNACGL
FLPFVDDKDVEMVGVEAGGKGTKLGEHSIRLSHNLGTPGIAQGFASIFIQDDAGQLQETH
SISAGLDYVGVSPIIAHLAKEGRINMTYAMDDEVVDACTLLLKNEGIIPALESSHALAGA
FKDAPSMSKDTHIVINLSGRGDKDIFNVAKALQDPTFPNFLNDYLEDYEKDTLIKKTEKE
A
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagcgataatggttactacggtgagtttggtggaagctacattccagaaatactc
tactccagccaacaacaaattctgaacgcttacgaagaagcgaagaatgaccctgccttt
atcgccgagctaaaacaacaatggcaagaatactcaggtcgccctacgccacttacattc
tgtaagaatttaacagaacattttggtggtgcgcagatttacttaaaacgtgaagattta
aaccattctggcgcgcacaaaatgaacaatgtgattggccaagggttgcttgttaaacgc
atgggtaaaaaacgcgtcatagctgaaacaggcgctgggcaacacggtatcgcaaccgcc
ctcgtttgtgctcgcttgggattagaatgcaccatttatatgggcgcaaaagatgtaaaa
cgccaatacccaaatgtcttctggatggagcaattaggtgcgactgttgtccctgtaaca
gaaggttctcaaacactaagagacgcattagacgaagcattacgagactggtcttcgaca
cacgaagacagccattacctaatagggacaacctgtggctgtgctcctttccctgaaatg
gtggccttctttcagtctgtcatcggcgaagaggtcaaagagcaaagtaaggctcagttt
ggtcgatacccagataaactctacgcttgtgtcggtggcggctctaacgcttgcggactg
ttccttccatttgtagacgacaaagacgtcgaaatggtgggtgtcgaagcaggcggtaaa
ggcacaaagctgggcgagcactctattcgtttgtcccataatttaggcacaccggggatt
gcccaaggttttgccagcatctttattcaggatgatgcggggcaacttcaagaaacccat
tctatttccgccggtttagattacgttggtgtctctcctattatcgcgcacttggcgaaa
gaaggccgcatcaatatgacctacgctatggacgatgaagtggtcgatgcctgcacgtta
cttttgaaaaatgaaggcattatccctgcacttgaatcctctcacgcattagcaggcgcc
tttaaagatgcgccttcgatgtcgaaagacactcacatcgtcattaacttgtctggtcgt
ggtgataaagacattttcaacgtcgcaaaagcactgcaagaccctacgttccctaacttc
ttaaacgactacttagaagactacgaaaaagatacgttgattaaaaaaacagaaaaggag
gcatag

DBGET integrated database retrieval system