KEGG   Marinomonas mediterranea: Marme_2886Help
Entry
Marme_2886        CDS       T01449                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mme  Marinomonas mediterranea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marme_2886
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marme_2886
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Marme_2886
Enzymes [BR:mme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Marme_2886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3161688..3162476
Genome map
AA seq 262 aa AA seqDB search
MSQLANYINAKRESKPILSMTHVVYGYPTVEESLTWMGTLLENGADFIEVQFPFSDPVAD
GPTIVAACHKALEQTLSVEQCLKDIGQLAKKYPESRLVLMSYLNPMYRYGLDKLVERCAE
EGILGLILPDLPYEQAGGLRAACDKHGIDPVWLVTPVTPKDRMAFLASNAQGFLYCVARS
GVTGNSNHDGEGAQTELQHYLASIQSDSSAPLGVGFGLRRREQIKELEGHADIAILGSAL
LDAYNQGGQETGIALFKELFSH
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaattagcaaactacataaacgctaaacgcgagtccaaacccattctgtctatg
actcacgttgtctatggataccctactgttgaagagagcttaacgtggatgggcactcta
cttgagaacggtgcggattttatcgaagttcagttccctttttccgaccctgttgccgat
ggcccaacaatcgttgcagcctgccacaaggcgttagaacaaaccttatccgttgagcag
tgtcttaaggatattggccaattagctaaaaaataccctgaaagccgtttagtgttgatg
agttacttgaacccaatgtatcgatacggcttagataaactggttgagcgatgcgctgaa
gaaggcattttaggactgattctacctgacttaccttatgagcaagctgggggcttaaga
gcagcctgtgacaagcacggcatagatccggtttggttggttacgccggtgacaccaaag
gatcgaatggcatttcttgcatcaaatgctcaaggctttctctattgtgtggcccgttct
ggagtgacgggtaattccaatcacgatggtgaaggtgcgcaaaccgagcttcaacactac
cttgcttcgatccaaagcgattcaagtgcgccattgggcgttggatttggattgcgtcga
cgagagcaaataaaagagctcgaaggtcatgccgatatcgccattctgggctcggctttg
ttagatgcttacaaccaaggcggtcaagaaacaggaatcgctttatttaaggaactgttt
agccattaa

DBGET integrated database retrieval system