KEGG   Marinomonas mediterranea: Marme_2899Help
Entry
Marme_2899        CDS       T01449                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
mme  Marinomonas mediterranea
Pathway
mme00071  Fatty acid degradation
mme00280  Valine, leucine and isoleucine degradation
mme00281  Geraniol degradation
mme00310  Lysine degradation
mme00362  Benzoate degradation
mme00380  Tryptophan metabolism
mme00410  beta-Alanine metabolism
mme00640  Propanoate metabolism
mme00650  Butanoate metabolism
mme00903  Limonene and pinene degradation
mme00930  Caprolactam degradation
mme01040  Biosynthesis of unsaturated fatty acids
mme01100  Metabolic pathways
mme01110  Biosynthesis of secondary metabolites
mme01120  Microbial metabolism in diverse environments
mme01130  Biosynthesis of antibiotics
mme01200  Carbon metabolism
mme01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Marme_2899
   00650 Butanoate metabolism
    Marme_2899
  Lipid metabolism
   00071 Fatty acid degradation
    Marme_2899
   01040 Biosynthesis of unsaturated fatty acids
    Marme_2899
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Marme_2899
   00310 Lysine degradation
    Marme_2899
   00380 Tryptophan metabolism
    Marme_2899
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Marme_2899
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Marme_2899
   00281 Geraniol degradation
    Marme_2899
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Marme_2899
   00930 Caprolactam degradation
    Marme_2899
Enzymes [BR:mme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Marme_2899
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Marme_2899
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Marme_2899
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     Marme_2899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADZ92121
JGI: Marme_2899
UniProt: F2K009
Position
complement(3177903..3180062)
Genome map
AA seq 719 aa AA seqDB search
MIYDGQALKVTKEADGVATLTLDLAGDSVNKFNSLTLNELAEAVDSLKQEPDVKGLIINS
AKDVFVVGADITEFVNWFKLSDEELSDKLRDAHQIFSDISNLPFPTVAAINGIALGGGME
LCLACDYRVMAQKAKIGLPETQLGIYPGWGGTVRLPRLIGVDNACEWICGGAQKRSEDAL
KDGAVDAVVPVEKVVTSARHLIQHVIDGKLDVMARREELRAPMVFSPIEKMMVFESVRGV
VGAKAGKHYPAPMAAIKTMEKNVSQTIEKACETEIKGFVKVAKTPVAKSLVNLFLNDQYV
KKAAGTFSKGADPVKQAAVLGAGIMGGGVAYQSASKGTPIIMKDIRSEALDLGLSEANKL
FGKQVERGRLTNEKSMKALNSIVPALSYGEFEGVDLVVEAVVENVNVKKSVLAETENHIR
DDAVLASNTSTISITELSKALKRPENFCGMHFFNPVHRMPLVEVIRGEKSSDEAVAKTVA
YAQAMGKTPIVVNDCPGFLVNRVLFPYFAGFSLMMKEGADFQKIDKVMERFGWPMGPAYL
IDVVGIDTAYHADQVMADGFPDRMTHDGKNAIDKLFEVERFGQKNEKGFYRYEQDRKGKP
KKIYDPEITTLLAETVDAAGTNGELSDEDIIARMMIPLCIETVRCVEEGIVSSPAEADMG
LIYGIGFPPYLGGALHYLDQMGLKAFCDLADKYSHLGKLYQPTARMREMADNNETYFQA
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgatctatgacggacaagctctcaaggtgacgaaagaggcagacggtgttgcgacgtta
accttggaccttgcaggggattcggtaaataagtttaacagcctcacgcttaacgaactt
gccgaagcggttgactcactcaagcaagagcccgatgttaaaggcctcatcattaacagc
gctaaagatgtatttgttgtcggcgccgacatcacagaatttgtgaactggttcaaacta
tcggacgaagagttgtcagataagttgcgcgatgcgcatcagatcttttcagatatatct
aatcttccttttccgacggttgctgcaataaatgggattgctttaggcggagggatggag
ctttgtctagcgtgcgattaccgagttatggcgcaaaaagcgaagatcggactgcctgaa
actcagcttggaatttaccctggttggggtggaacggttcgattacctcgtctgattggt
gtagataacgcttgtgaatggatttgtggcggcgctcaaaagcgcagtgaagatgcgttg
aaggatggagcggtcgatgcggttgtgccagtcgaaaaggtcgttacgtcagcgcgacac
cttatccagcatgtgatcgatgggaagctcgatgtcatggctcgtcgagaagagcttcgc
gcgccgatggtattttctccgatagaaaaaatgatggtatttgaatccgtgcgtggcgtg
gtcggagccaaagcgggtaaacactacccagcgccgatggcggccatcaaaacgatggaa
aaaaacgtaagtcagactatcgaaaaagcctgtgaaacagaaatcaaaggttttgttaaa
gtggcaaaaacgccggtagcaaaatcattggttaacctgtttttgaacgatcaatacgtt
aagaaagcagccggtactttctccaaaggagcggatccggtaaaacaggccgcagtactt
ggtgcgggtattatgggtggcggcgtggcttatcagtctgcctcaaaaggcacgccgatt
ataatgaaagacatacgctcagaagccttggatttaggtctttctgaagccaataagttg
tttggcaagcaagtagagcgcggtcgcttaacaaatgaaaaatcgatgaaggcacttaac
agtattgttcccgcgttaagttacggtgaatttgaaggtgtcgatcttgtcgttgaagcc
gtcgttgaaaatgtcaatgttaaaaagtctgtcttagccgaaactgaaaatcatatccgt
gatgatgctgtattggcatcaaatacctcgactatctccattaccgaattatcgaaagcg
ctaaaacggccagaaaatttctgtggaatgcacttttttaacccagtgcaccgcatgcca
ttggtggaagtgatacgtggtgaaaaatccagtgatgaagccgttgcgaaaacggtcgct
tacgcacaagcaatggggaaaacgcctattgttgttaacgactgccctgggttcttagta
aaccgcgtactgtttccttacttcgctggcttctctctcatgatgaaagagggcgcagac
tttcagaaaattgataaggtgatggagcggtttggttggccgatggggccagcctatttg
attgatgtcgtcggtattgatacggcgtatcacgcagatcaagtcatggcagacggtttt
ccagatcgtatgactcatgatggtaagaatgccattgataaactgtttgaagtagagcga
ttcggccagaaaaatgaaaaaggtttctatcgttatgagcaggatcgcaagggcaaaccg
aagaagatctatgacccagagattacgacgttattagcggaaacagtcgacgcagccgga
acaaacggcgaactaagcgacgaggacatcattgcaaggatgatgattccactttgtatt
gaaacggttcgatgtgttgaggaagggattgtgagctctccagcagaagcagacatggga
cttatttatggtattggtttccctccataccttggtggtgcattgcattatctcgatcaa
atgggattaaaggcgttctgcgatttagcagataaatacagccatttaggtaaattgtac
cagccaacagcgcgcatgcgggaaatggccgataacaacgaaacctattttcaagcataa

DBGET integrated database retrieval system