KEGG   Marinomonas mediterranea: Marme_2930Help
Entry
Marme_2930        CDS       T01449                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mme  Marinomonas mediterranea
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Marme_2930
Enzymes [BR:mme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Marme_2930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3215451..3216344)
Genome map
AA seq 297 aa AA seqDB search
MTIYNFGSINLDHVYQVDHFVRPGETMASESYQCLLGGKGANQSAALAKAGADVKHVGAV
HTVDKQVLRQLQEIGVDTALVAQLDMPTGHAIIQINKSAENSIILYPGANHCLTEAQVDE
VLKKTSEGDWVLLQNETNLVDYVARQAKSKSLKVAYNPAPMNVEMTKPLLSSIDLLIVNE
VEAMDLVAVSSIEEAVEAMPKHYPDLAVLMTLGSDGVRYFDKGVDLYVPAFSVDAIDTTA
AGDTFIGFSMAALFNGQSIEDAIKQGCAASAICVTRIGALAAIPELEEVTTFMSHQQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctacaatttcggctcaattaaccttgatcatgtttatcaagttgatcatttc
gttaggcctggggaaacaatggcctcggaaagctaccagtgcttattgggcggtaaaggg
gcaaatcaatctgcagctctcgctaaagcgggcgctgatgtaaagcatgttggagcggtg
catacggtcgataaacaagtgctaaggcaattgcaagaaataggcgtagataccgcactt
gtagcgcaattggatatgcctactggtcacgctattattcagattaataagagtgctgag
aactcgattattttataccctggtgcaaatcattgtttaaccgaagctcaagttgacgag
gtcttgaaaaaaacatctgagggggattgggtgctactacagaacgagacaaacctcgta
gattacgtagcacgtcaggcgaaaagtaaatcgctaaaagtcgcctacaatcctgcccct
atgaatgttgagatgaccaagccgcttcttagtagcattgatttactcattgtaaacgaa
gtcgaagcaatggatttagtagcggtaagctctatcgaagaggccgttgaggcgatgccc
aagcattaccctgatctagcggtcttaatgacgcttggaagtgacggcgtgcgttatttt
gataagggtgttgacctttatgtacctgcattttctgtggatgctatagacacaacggcg
gcaggagatacgtttattggtttttctatggcggcgttatttaatggtcagtcaatagaa
gatgcgattaaacagggatgcgcggcatcagcaatatgcgtgactcgcataggcgcactc
gctgcgattccagaattagaagaagtgacaacctttatgtcacatcagcaataa

DBGET integrated database retrieval system