KEGG   Marinomonas mediterranea: Marme_2955Help
Entry
Marme_2955        CDS       T01449                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mme  Marinomonas mediterranea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Marme_2955
Enzymes [BR:mme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Marme_2955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3248073..3248855
Genome map
AA seq 260 aa AA seqDB search
MTEQKPLSSIRVLVTRPEPENASTCAHLTSLGAQPIPLPSLYIEAFEEDDKIRSIQSQLF
DLDLYKYVIFVSKNAARIGAERIEECWPMLPAQLHWIGIGKGTTKTLNDLGFPALSNPGF
TSEALLNWLKPVKLTDEKILIVRGEGGRPTLADGLEAKGASVDLLELYKRIKPNYSAQTF
LFLDEPDLIWSTSEDSLRNLTQDIMQYQASWLDKPIFVPSQRVADTASELGWKNIINANG
ADDSRLTEATLQHLGRKDDR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaaaagcctttatcaagcattcgagttttagtcacgcgacctgagccagaa
aatgcgtcgacctgcgcacatttaacctctcttggggcacaaccaattccgttgccctca
ctctatattgaggcatttgaagaggacgataaaatccgctcaattcaatcgcagctgttt
gacttagacttatacaaatacgttatatttgtaagtaagaatgcagctagaattggggcg
gaacgaatagaggaatgctggcctatgctgccagctcaactacactggattggaataggt
aaagggacaaccaaaacattaaatgatttaggcttccccgcgctttctaatcccggcttt
acatcagaagcacttttaaattggctcaagcccgttaagctaacagacgaaaaaatactg
atcgtacgtggcgagggcggaagaccaactcttgcagatgggttagaagcaaaaggcgca
agcgtagatttgcttgaactatacaaacgcataaagccaaactatagcgcacaaactttt
ttattcttagacgaacctgacttaatatggtctacaagtgaggatagccttcgcaacctc
actcaggatatcatgcagtatcaagcaagctggctagacaagcctatatttgtacctagc
caacgtgtcgcagacactgcctcagaacttggctggaagaacattataaatgcaaacggc
gccgatgacagtcgcttaaccgaagcaaccttgcagcacttaggacgcaaagatgaccga
taa

DBGET integrated database retrieval system