KEGG   Marinomonas mediterranea: Marme_2967Help
Entry
Marme_2967        CDS       T01449                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mme  Marinomonas mediterranea
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Marme_2967
Enzymes [BR:mme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Marme_2967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3261413..3262318
Genome map
AA seq 301 aa AA seqDB search
MTNHSISLPSPAKLNLFLHITGRRNDGYHELQTIFQFINVCDQLDFTTTNDALVHILPAI
KGVPLEENLIYKAAQALKPFAKNEAFGANISLKKRLPMGGGIGGGSSNAATTLLALNQLW
QCDLSTDALANIGRHLGADVPVFVRGNAAFAEGIGELLTPVEPETPFYLLVKPDCHVATG
QIFADKYLTRDTPPIRIAHALKLSGQNDCLEVVKKHNPEVNEAFEWLQDYGDVKLTGTGA
CLFIAYNTIEDAERVRASVPKKWQTWVCQGCNVSPTHLALNQWIKKQKSLRLNSELSKPD
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaccactcaatatctctcccctcacccgccaagctcaatctatttttgcacatt
acaggacgccgaaacgacggctatcacgagctacaaactattttccagtttattaatgtc
tgcgatcaacttgactttactactacaaacgacgccctagtccatatattaccggcaata
aaaggcgtccccctagaggaaaacttaatatacaaggctgctcaagccctaaagcccttc
gcaaaaaatgaagcgtttggagcaaacatatccctaaagaaacgtctaccaatgggaggg
gggatcggcggaggaagttccaatgcagcaacaacgttactcgcgcttaaccaactatgg
caatgcgacctatcgaccgatgcactcgcaaacattggcagacacttaggagctgacgta
cccgtttttgtaagaggaaacgcagcctttgcagaaggaataggtgaactcctaacacca
gtagagccggaaaccccattttatctactggtaaaaccagattgccatgtcgcaactggt
caaatttttgccgataaatatttgacaagagacaccccgcccatcagaatagcgcacgct
ttaaagctgagtggacaaaacgactgtttagaggttgtaaaaaagcataatcctgaagtg
aacgaggcatttgaatggcttcaagactacggtgacgtaaagctaaccggaacaggcgcg
tgcttatttatagcttataacacgatcgaagacgctgagcgagtgagagcgtcagtaccc
aaaaaatggcagacttgggtttgtcaaggttgcaacgtatctcctactcatttagcactc
aaccagtggattaagaagcaaaagagcctgcggctcaacagcgaattaagtaagccagat
gaatag

DBGET integrated database retrieval system