KEGG   Marinomonas mediterranea: Marme_3122Help
Entry
Marme_3122        CDS       T01449                                 

Definition
(RefSeq) pectinesterase (EC:3.1.1.11)
  KO
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mme  Marinomonas mediterranea
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Marme_3122
   00500 Starch and sucrose metabolism
    Marme_3122
Enzymes [BR:mme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Marme_3122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3432437..3433462
Genome map
AA seq 341 aa AA seqDB search
MSKTHYSAHVSQSRKPSTFSSITHALQSAPDDNRPFTIHIDEGVYEERLNITRNNVHLVG
AGKKNTVITGSMVAGQLNNSGELISTLGSRTLMINATDCSLTSLTIRNDFDYINNALLAL
DSNDRVKHTQAVALLLGNDCDRCIIDDVRLQGFQDTLFVKGSRSYFYQCDITGNIDFIFG
NGNAVFDQCTVVARNTPTSLKSMGYLTAPSTPLDQEFGLTFLDCQLVKESADIPIQSYAL
GRPWHPTTSFSDGKYADPNAIGKTTFIRCFMGDHIYGWDKMGGKDKHGNQIYFLPECDAR
FNEYQCHGPGANSTRFQLSSLDAHKYSIDSILEGWLPKIAG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacacactacagcgcgcatgtctcccaatcacgtaaaccgagtactttttca
agcataacccacgctttgcaaagtgctcctgatgacaatcgcccattcacaatacatatt
gatgagggggtctatgaagaacgactcaatatcactcggaacaatgtacacctagtagga
gcaggcaaaaaaaataccgttattacaggaagcatggtcgcgggacaacttaataacagc
ggtgaactcattagtacgcttggcagcagaacactcatgataaacgcaacagattgcagc
ctaacatcgctaacgatacgcaatgactttgattatataaataatgctttactggcactc
gattctaacgaccgagtaaaacatactcaagccgtcgcacttctattggggaacgattgc
gacagatgcattattgatgatgttagactccaaggctttcaagacaccttgtttgtaaag
ggttcaagaagctatttttaccagtgtgatattacaggtaatatcgattttatttttgga
aacggcaatgcggtatttgatcaatgcacagtcgtcgcacgaaatacaccaacaagttta
aaaagtatggggtatctcaccgccccaagcacaccactagatcaggagttcggcctcaca
tttcttgactgccagctcgttaaagaaagcgcggatatcccaatacaaagctatgcatta
gggagaccttggcacccaaccacctcattttccgatggtaaatatgccgacccaaatgca
attggaaaaacaacctttatccggtgttttatgggcgaccatatctatggttgggataaa
atgggcgggaaagacaaacatggtaatcagatctattttttacctgaatgtgacgcacga
tttaacgagtatcaatgccatggtcccggagcaaacagtacgcgttttcaattgagctca
ttggatgcccacaaatattctatcgattctattctagaagggtggctccctaagattgca
ggctaa

DBGET integrated database retrieval system