KEGG   Marinomonas mediterranea: Marme_3128Help
Entry
Marme_3128        CDS       T01449                                 

Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mme  Marinomonas mediterranea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Marme_3128
Enzymes [BR:mme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Marme_3128
Exosome [BR:mme04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Marme_3128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3440887..3443055
Genome map
AA seq 722 aa AA seqDB search
MDLFEDIVNARCSDPFGFLGLHWTEEKDLKLNVWRPDAVAIDVLAIDADSVIGKMNLNTD
SGLFSCQWSDKKTFFHYRLRITFSDGNTATFVDPYQFNQATFADPEHHKATLYQKEGALF
QSAPVTDSLAIDGTRFAVYAPAARSVYVVGDFNGWDGRIHPMSSNGDGVWRLFIPDVRDG
AKYKFEIRAKSGDLLPHRTDPFAKRIEQFPSFASVVQESQYHWNDESWMSRPISDIYEEA
VSIYEVHLGSWRKKEHNESLTYLELKEQLVPYVVEMGYTHVELLPVMEYPFDGSWGYQPV
GLFAVTSRYGTPDEFKALIDAFHQAGISVIMDWVPAHFPSDSHGLANFDGTHQYEYEDPK
KGWHPEWNSLIYDFGKEHVVDFLISNANFWLEEYHIDGLRVDAVASMLYLDYSREDGEWI
PNVHGGNHNYEAIAFLKQLNETVYLNHPRCFTVAEESTAFSGVSKPTYMDGLGFGFKWNM
GWMNDTLEYMKKDPIHRQYHQGELTFSMVYAFNEQFMLPISHDEVVHGKGSMIDKMPGDG
WQKFANLRAFNGYMFTHPGKKLNFMGNEFAQGQEWSHTRSLDWHLLDIDYHKGLQTLVKD
LNHLYTGEPALQLDHDYQGFEWLSYDDSQNSILAYVRQSKAKDELLIVVVNFTPTPHKGY
RIGAPKLGRYDLILNTDASIYGGSGFHTAQTLEAESIENHGRNDSVMLDIPPLSTVIYKW
KS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggatctgtttgaagacattgtaaatgcccgctgttccgaccctttcggattccttggc
ctacactggactgaagaaaaagacttgaaacttaacgtttggcgacctgatgccgtcgcg
atcgatgtacttgcaatcgacgcagactcagtcattgggaaaatgaatttaaacactgac
agcggactgttctcttgtcagtggtcggataaaaaaacgtttttccactaccgtctcaga
atcacattctcagacggcaatactgcaaccttcgtcgatccttatcagtttaatcaagca
acgtttgctgatcctgagcatcacaaagcaaccctttaccaaaaagaaggcgctctgttt
caaagtgcgccagtaacggattctctagcgatcgatggaactcgatttgctgtctatgcc
cccgcagctcgttcagtatacgtcgtgggcgactttaacggctgggacggccgtatccat
ccgatgtcgagcaatggcgacggagtatggcgactcttcattcctgatgtccgagatggc
gcgaaatataagtttgaaatcagagcaaaatcaggcgacctactgccacatagaaccgat
ccctttgcaaaacgaatcgagcaatttccttcatttgccagtgtcgtacaggaatcccag
taccactggaatgatgaaagctggatgtcgcgacctatatcagatatttacgaagaagcg
gtcagtatatatgaggtacatctcggctcttggagaaagaaagagcacaacgagtcgctt
acttatctagagttgaaagagcaacttgtaccgtatgttgtcgaaatgggttatacgcac
gtagaactgctacctgttatggagtacccgtttgatgggtcttggggttatcaacctgtt
ggcttattcgcggtaacgtctcgatacggcacaccagacgaattcaaagcgttaatcgat
gcattccatcaagctggaatcagtgtcattatggattgggttccagcgcatttcccatcc
gatagccatgggctcgcgaactttgatggaacccatcagtacgagtacgaagacccgaaa
aaaggctggcaccccgaatggaactctttgatctacgattttggtaaagaacacgtcgtt
gacttcctaatcagcaacgcaaatttctggttagaggaataccatattgacggcctgcga
gtcgatgcggttgcatccatgttgtatctggattactcacgcgaagacggcgaatggatt
ccaaatgttcatggcggcaatcacaactacgaagcgattgcgttcttgaaacaactgaat
gagacggtttacttgaaccacccacgttgtttcacagttgcagaagagtctaccgccttt
tcaggcgtgtctaaaccgacctatatggacggcctagggttcgggttcaagtggaatatg
ggctggatgaacgataccttagagtatatgaagaaagacccgattcaccgtcaataccat
cagggtgagctcaccttctccatggtatacgcctttaatgagcagtttatgctgcctatt
tcacatgacgaagtggttcatggaaaaggctctatgatcgacaaaatgcccggcgatggc
tggcagaagtttgcaaaccttagggcgttcaatggctacatgtttactcaccccggtaag
aaactaaactttatggggaacgaatttgctcaaggtcaagaatggagccacactagatcc
ctagactggcacttgctcgatatcgattaccacaaagggctacaaacactggtcaaagac
ttaaatcacctctataccggtgagcctgcgctgcaactagatcacgattatcaaggattt
gaatggctttcttatgatgacagtcaaaactccattcttgcttacgtaaggcaatctaag
gcaaaagatgaattactgatcgttgttgtgaattttacaccaacacctcacaaaggttac
cggataggtgcgccaaaattagggcgctatgacctgattttaaatactgatgcctctatc
tatggtggaagtgggttccacacggcacaaacgcttgaggctgaaagcattgaaaaccac
ggtagaaacgacagtgtcatgctcgatattccaccactttcaactgtaatctataaatgg
aaatcttag

DBGET integrated database retrieval system