KEGG   Marinomonas mediterranea: Marme_3470Help
Entry
Marme_3470        CDS       T01449                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mme  Marinomonas mediterranea
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3816700..3818226
Genome map
AA seq 508 aa AA seqDB search
MSTAQDKLVEALRKTVSRTSMLAEGSDPELDKVLQQVRADVSKTDDIRVVELAMRTIEPF
LLKLDEDRLSKAQSFRDGLHQLLNTLEGLEHYQVPINEKRAFEQSLRSKWQSSTSWPILL
QQFSELAKLTFTTKKDERSSSLISRLFKKDKEEDKASPQVEEVTAHICHKLIALVRDLQL
PSEYENQAEDIISELNDHKDLNHLPILLDEVISLVLVAVGKPQEDLATYLTHLNKQLASI
NASIVTSYKSQKNLTAHREDFDTSLQKHVEDTNSALLEASDLGALKSLIGQHMVELSGTM
GRYREQIKKQEEQATQSITNLKSKVNRMEKDATNMRSRMQQKIAEAMTDSLTNLPNRAAY
LETILPLIVNSKKTNKPLCLAVCDIDHFKKINDTWGHLAGDKVLRLVPKQILSAVGKEDL
LFRYGGEEFVLLIPASTVEECHVKVEAVRASVEKTPFNVEGQPVSVTISIGMDYLNANDD
HESIFARADKHLYEAKESGRNKVVSGKA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagctcaggacaagttagtagaagccctacgtaaaactgtttctcgtaccagc
atgctggccgaaggctctgatcctgaactagacaaagttctccagcaagttcgcgccgat
gtctctaaaacagatgatattcgagtcgtcgaacttgcaatgcgtactattgaacccttc
ctgctaaaactcgatgaagatcgtcttagtaaagctcaatctttccgagacggtcttcat
cagcttctaaatacgctagaaggcctagagcactaccaagttcctatcaacgaaaagaga
gcttttgagcaatcactgcgcagtaaatggcaatccagcacttcgtggcccattctgcta
caacagttttcagagcttgccaagctcacgttcacaaccaaaaaggacgagcgctcttct
tccttaatttcacgtttatttaagaaagataaagaagaagataaagcttctcctcaggtc
gaagaagtaaccgcgcatatttgccacaagctcatcgcccttgttcgcgaccttcagctt
ccatccgaatacgagaaccaagctgaagacattatcagtgagctaaatgaccataaagat
ctaaatcacttaccgattcttttggacgaagtgatcagtcttgttttagttgccgtaggt
aaacctcaagaagatctagccacttacctgacgcatttaaataaacaacttgcgagcatc
aatgcctcaatagttacgagttataaaagtcaaaaaaacctaaccgctcatcgagaggac
ttcgacacgtctctacaaaagcatgttgaagatacgaactcagcgctcttagaagccagt
gatttaggtgctcttaaatccctaattggtcaacatatggttgagctaagcggaacaatg
ggacggtatcgcgagcagatcaagaagcaagaagaacaggcaactcagtctattaccaac
ttaaaaagtaaagttaatagaatggaaaaagacgcgactaacatgcggtcgcgcatgcaa
caaaaaatcgccgaagcgatgactgactcactgaccaacctaccaaacagagcggcgtac
ttagaaaccattctccctctaatagtgaactccaaaaaaacgaacaagccactctgcttg
gctgtttgtgacatagaccatttcaaaaagataaacgacacttggggacacctcgctggt
gacaaagtccttcgcctagtccctaaacaaattttgagtgcggttggcaaagaagactta
ttattccgctatggcggcgaagagtttgtgctgctgattcctgcgtctacggtagaagaa
tgccatgttaaagtagaagcagttcgcgcctccgtcgaaaaaacaccgttcaacgttgaa
ggtcaacccgtgtccgtcacgatttctattggtatggattaccttaacgctaacgatgat
catgaatctatcttcgcaagagcagacaaacacttgtacgaagcaaaagaatcaggtcga
aacaaagttgttagcggcaaagcttag

DBGET integrated database retrieval system