KEGG   Marinomonas mediterranea: Marme_3524Help
Entry
Marme_3524        CDS       T01449                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mme  Marinomonas mediterranea
Pathway
mme00072  Synthesis and degradation of ketone bodies
mme00650  Butanoate metabolism
mme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Marme_3524
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Marme_3524
Enzymes [BR:mme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Marme_3524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Methyltransf_25 Polysacc_synt_2 3Beta_HSD 2-Hacid_dh_C Methyltransf_12 Methyltransf_31 3HCDH_N CNOT1_TTP_bind MTS DUF1776 RmlD_sub_bind NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: ADZ92737
JGI: Marme_3524
UniProt: F2JUB8
Position
3875240..3876013
Genome map
AA seq 257 aa AA seqDB search
MNNKTVLITGAASGIGLEIAQAFLKADMNVAILDFSQTAIEEAKTQLSAFHQKCTFFACD
VTKEPQFMDAIDAAIAQFGHIDILINNAGVQHIAPIEEFPSDTYRRLIDIMLIAPFLAIK
KILPLMKEKGDGRIINMSSINGLIGFAGKAGYNSAKHGVIGLTKVAALEAAPFGVTINAL
CPGYVDTPLVRNQLEDLAKTRNVSLDRVLEEVIWPLVPQRRFLTVDEISDYCLFLSSPSA
KGVTGQAIVIDGGYTTQ
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataaaacagtattaattacgggggcagcaagtggaatcggtttggaaattgct
caggcatttctgaaagcggacatgaatgtcgccattttagatttcagccaaacggcgata
gaagaggcaaaaacacagctttcagcattccatcagaaatgcacttttttcgcctgcgat
gtgactaaggaaccgcaatttatggacgcgatagacgccgccattgcgcaatttggccat
atcgatattctgatcaacaacgcgggggttcaacatatcgcgccgatagaagaattcccc
tcagacacctaccggcgtttaatagacattatgttgatcgcgccctttttggcgatcaaa
aaaatcctgcctttgatgaaagaaaaaggggatggacgaatcattaacatgtcgtcgatt
aatggcttaatcggctttgcaggcaaagctggctacaattctgccaagcacggcgtaatt
ggcctaacaaaagtagctgcgctggaagccgcgccttttggtgtgaccatcaatgcgctg
tgccccggctatgtggacacgccattggtgagaaatcagctggaggatttggcgaaaaca
cgcaatgtctcacttgatcgtgtgttggaggaggtcatttggcctctggtaccgcaacgc
cgcttcctcacggtagatgaaatttcagactactgtttgtttctcagcagcccttcggca
aaaggagtgacaggacaagctatcgtcatcgacggtggctataccacacagtag

DBGET integrated database retrieval system