KEGG   Marinomonas mediterranea: Marme_3608Help
Entry
Marme_3608        CDS       T01449                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mme  Marinomonas mediterranea
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Marme_3608
Enzymes [BR:mme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Marme_3608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3983365..3983856
Genome map
AA seq 163 aa AA seqDB search
MTAHIVYIGLGSNLNDPLTQLKDAISYLSAHPSIESFECSRLYSSKPVGPQDQPDYINAV
ARFSSTLPPIELLDLLQSVEQNHHRVRERHWGPRTLDLDILLIDRETISHPRLNVPHPFM
LERGFVIQPLSDLAPELLLSNGKSVEEHVKQLDTSDLVSIEKE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcatattgtatatattggactaggtagcaatttaaacgacccgctgacacaa
ttaaaagacgcgattagctaccttagtgctcatccaagcatagaatcctttgagtgttct
agactgtattccagcaagcccgttggccctcaggatcagcctgactacatcaacgccgtc
gcccgatttagctcaacactcccccctatcgagctactcgacttattacaaagtgttgaa
cagaatcatcaccgagtacgcgaaagacactggggcccgagaacacttgatttagacatc
cttttaatcgacagagaaaccatctcccatccacgattaaacgtacctcatccatttatg
ctagaaagagggtttgtgatccaacccctatctgacctagcacctgaactgcttctttct
aacggcaaatccgtcgaagagcatgtaaagcaacttgataccagcgatttggtctcgatt
gaaaaagagtag

DBGET integrated database retrieval system