KEGG   Marinomonas mediterranea: Marme_3628Help
Entry
Marme_3628        CDS       T01449                                 

Definition
catechol 1,2-dioxygenase (EC:1.13.11.1)
Orthology
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
mme  Marinomonas mediterranea
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Marme_3628
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Marme_3628
   00364 Fluorobenzoate degradation
    Marme_3628
   00361 Chlorocyclohexane and chlorobenzene degradation
    Marme_3628
   00623 Toluene degradation
    Marme_3628
Enzymes [BR:mme01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     Marme_3628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4003327..4004253)
Genome map
AA seq 308 aa AA seqDB search
MTVKTMQTEAVKALLHKVAGFDNNEGNPRAKEIVARLVTDIFQMVEDLDVTPEEFWHGVN
YLNELGSNMEAVLLAPGLGFDHFLDIREDAKDEQMGLLGGTPRTIEGPLFVEGAPKDQTV
TRMDDGNTPGQGMWLHGQVTDETGAPVAGAVVDLWHADKKGAYSYFDTTQSDFNLRRKVV
TDENGYYYARSIVPNGYGCPPGGSTMKVLDLLGRHGNRPAHIHFFAAKSGYKHLTTQINL
AGDKYTFDDFAFATRDELVVEATSVSDAAKIAEHGFDGEYLDVEFNLSIIKTDKEELADK
HVRARAAV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgactgttaaaacaatgcaaacagaagcagtgaaagcgttattacacaaagtggcaggc
tttgataataacgaaggaaacccacgagctaaggaaattgttgctcgcctcgttaccgat
attttccaaatggttgaagatttagacgtaacgccggaagagttttggcatggcgttaac
tacctaaatgagttgggaagtaacatggaagccgtacttttggctccaggtttaggtttc
gaccacttcctagacattcgtgaagacgcgaaagacgagcaaatgggtctattaggtggt
acgcctcgtacaatcgaaggaccattgtttgttgaaggcgctccaaaagatcaaacggtt
acacgcatggacgatggcaacactcctggccaaggaatgtggttgcatggtcaagtaaca
gatgaaacgggtgcgcctgtggctggtgcagtggttgatttgtggcatgctgataaaaaa
ggtgcgtattcatactttgacacgactcaaagcgacttcaacttgcgtcgtaaagtggta
acggatgaaaacggatactactacgctcgcagtatcgtaccgaatggctacggttgccct
ccaggtggttctacaatgaaagtgttagatcttctaggtcgtcacggtaatcgcccagcg
catatccacttcttcgctgcgaaatctggctacaagcatctcacaacgcagatcaaccta
gcaggtgataagtacacgtttgatgacttcgcatttgcaacacgcgacgagcttgttgta
gaagcgacttctgtatcagacgcagctaaaattgctgaacatggctttgatggcgaatat
cttgatgttgagttcaacttatctattattaagacggataaagaagagctagcagacaag
catgtacgtgctcgcgcagcggtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system