KEGG   Marinomonas mediterranea: Marme_3628Help
Entry
Marme_3628        CDS       T01449                                 

Definition
(GenBank) catechol 1,2-dioxygenase
  KO
K03381  catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
mme  Marinomonas mediterranea
Pathway
mme00361  Chlorocyclohexane and chlorobenzene degradation
mme00362  Benzoate degradation
mme00364  Fluorobenzoate degradation
mme00623  Toluene degradation
mme01100  Metabolic pathways
mme01120  Microbial metabolism in diverse environments
mme01220  Degradation of aromatic compounds
Module
mme_M00568  Catechol ortho-cleavage, catechol => 3-oxoadipate
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Marme_3628
   00364 Fluorobenzoate degradation
    Marme_3628
   00361 Chlorocyclohexane and chlorobenzene degradation
    Marme_3628
   00623 Toluene degradation
    Marme_3628
Enzymes [BR:mme01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.1  catechol 1,2-dioxygenase
     Marme_3628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dioxygenase_C Dioxygenase_N CarboxypepD_reg
Motif
Other DBs
NCBI-ProteinID: ADZ92841
JGI: Marme_3628
UniProt: F2JV83
Position
complement(4003327..4004253)
Genome map
AA seq 308 aa AA seqDB search
MTVKTMQTEAVKALLHKVAGFDNNEGNPRAKEIVARLVTDIFQMVEDLDVTPEEFWHGVN
YLNELGSNMEAVLLAPGLGFDHFLDIREDAKDEQMGLLGGTPRTIEGPLFVEGAPKDQTV
TRMDDGNTPGQGMWLHGQVTDETGAPVAGAVVDLWHADKKGAYSYFDTTQSDFNLRRKVV
TDENGYYYARSIVPNGYGCPPGGSTMKVLDLLGRHGNRPAHIHFFAAKSGYKHLTTQINL
AGDKYTFDDFAFATRDELVVEATSVSDAAKIAEHGFDGEYLDVEFNLSIIKTDKEELADK
HVRARAAV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgactgttaaaacaatgcaaacagaagcagtgaaagcgttattacacaaagtggcaggc
tttgataataacgaaggaaacccacgagctaaggaaattgttgctcgcctcgttaccgat
attttccaaatggttgaagatttagacgtaacgccggaagagttttggcatggcgttaac
tacctaaatgagttgggaagtaacatggaagccgtacttttggctccaggtttaggtttc
gaccacttcctagacattcgtgaagacgcgaaagacgagcaaatgggtctattaggtggt
acgcctcgtacaatcgaaggaccattgtttgttgaaggcgctccaaaagatcaaacggtt
acacgcatggacgatggcaacactcctggccaaggaatgtggttgcatggtcaagtaaca
gatgaaacgggtgcgcctgtggctggtgcagtggttgatttgtggcatgctgataaaaaa
ggtgcgtattcatactttgacacgactcaaagcgacttcaacttgcgtcgtaaagtggta
acggatgaaaacggatactactacgctcgcagtatcgtaccgaatggctacggttgccct
ccaggtggttctacaatgaaagtgttagatcttctaggtcgtcacggtaatcgcccagcg
catatccacttcttcgctgcgaaatctggctacaagcatctcacaacgcagatcaaccta
gcaggtgataagtacacgtttgatgacttcgcatttgcaacacgcgacgagcttgttgta
gaagcgacttctgtatcagacgcagctaaaattgctgaacatggctttgatggcgaatat
cttgatgttgagttcaacttatctattattaagacggataaagaagagctagcagacaag
catgtacgtgctcgcgcagcggtataa

DBGET integrated database retrieval system