KEGG   Marinomonas mediterranea: Marme_3628Help
Entry
Marme_3628        CDS       T01449                                 

Definition
catechol 1,2-dioxygenase (EC:1.13.11.1)
Orthology
K03381  
catechol 1,2-dioxygenase [EC:1.13.11.1]
Organism
mme  Marinomonas mediterranea
Pathway
Chlorocyclohexane and chlorobenzene degradation
Benzoate degradation
Fluorobenzoate degradation
Toluene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol ortho-cleavage, catechol => 3-oxoadipate
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:mme01220]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mme00362]
Metabolism; Xenobiotics biodegradation and metabolism; Fluorobenzoate degradation [PATH:mme00364]
Metabolism; Xenobiotics biodegradation and metabolism; Chlorocyclohexane and chlorobenzene degradation [PATH:mme00361]
Metabolism; Xenobiotics biodegradation and metabolism; Toluene degradation [PATH:mme00623]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4003327..4004253)
Genome map
AA seq 308 aa AA seqDB search
MTVKTMQTEAVKALLHKVAGFDNNEGNPRAKEIVARLVTDIFQMVEDLDVTPEEFWHGVN
YLNELGSNMEAVLLAPGLGFDHFLDIREDAKDEQMGLLGGTPRTIEGPLFVEGAPKDQTV
TRMDDGNTPGQGMWLHGQVTDETGAPVAGAVVDLWHADKKGAYSYFDTTQSDFNLRRKVV
TDENGYYYARSIVPNGYGCPPGGSTMKVLDLLGRHGNRPAHIHFFAAKSGYKHLTTQINL
AGDKYTFDDFAFATRDELVVEATSVSDAAKIAEHGFDGEYLDVEFNLSIIKTDKEELADK
HVRARAAV
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgactgttaaaacaatgcaaacagaagcagtgaaagcgttattacacaaagtggcaggc
tttgataataacgaaggaaacccacgagctaaggaaattgttgctcgcctcgttaccgat
attttccaaatggttgaagatttagacgtaacgccggaagagttttggcatggcgttaac
tacctaaatgagttgggaagtaacatggaagccgtacttttggctccaggtttaggtttc
gaccacttcctagacattcgtgaagacgcgaaagacgagcaaatgggtctattaggtggt
acgcctcgtacaatcgaaggaccattgtttgttgaaggcgctccaaaagatcaaacggtt
acacgcatggacgatggcaacactcctggccaaggaatgtggttgcatggtcaagtaaca
gatgaaacgggtgcgcctgtggctggtgcagtggttgatttgtggcatgctgataaaaaa
ggtgcgtattcatactttgacacgactcaaagcgacttcaacttgcgtcgtaaagtggta
acggatgaaaacggatactactacgctcgcagtatcgtaccgaatggctacggttgccct
ccaggtggttctacaatgaaagtgttagatcttctaggtcgtcacggtaatcgcccagcg
catatccacttcttcgctgcgaaatctggctacaagcatctcacaacgcagatcaaccta
gcaggtgataagtacacgtttgatgacttcgcatttgcaacacgcgacgagcttgttgta
gaagcgacttctgtatcagacgcagctaaaattgctgaacatggctttgatggcgaatat
cttgatgttgagttcaacttatctattattaagacggataaagaagagctagcagacaag
catgtacgtgctcgcgcagcggtataa

DBGET integrated database retrieval system