KEGG   Marinomonas mediterranea: Marme_4095Help
Entry
Marme_4095        CDS       T01449                                 

Definition
monooxygenase (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
mme  Marinomonas mediterranea
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    Marme_4095
Enzymes [BR:mme01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Marme_4095
Cytochrome P450 [BR:mme00199]
 Cytochrome P450, animal type
  CYP1 family
   Marme_4095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4532007..4533494
Genome map
AA seq 495 aa AA seqDB search
MRYYEEDANVTDSPNRNAAPKLIPTIKLGSQDNHDMMWNEDFHLTITNMAKKYGAIYALE
TGKTTLIALNDHNAVREALVNQSDVFNIRADLEILQVAPQKHFLELEAGELWSLHRKTFA
TAMRDYFRDRWDTMDQWLVTEIDDIEAAWKSQGDQAVFDPNRDISIKLASFLHRVMFDRR
FGEFEESVFDEKSLSWLPAGFINSTRYELMPEHNKESYYAHYGDVIEKFASNLNGLDAYV
SMNVLKEKECYNKGQYRHLTDFLLNACDDIPNDVKQQVGATEKEIIIGSLTQVAGAGGGV
GAFALRWMLLYLASFPEKQKQVHAELDQVIGQNETPQQSHKGDLHYTQAFIAEVLRHCSI
TSMPASNYAASKDTFIDGYFVAKGTPLIVNNYGMTRDEALWENPDEFIPERFLEADGTFS
KKQQAKSFPFGIGQRRCLGELFGKFLINTLFTHLAHRFEFSLPNNEPINLRAISGVFLVP
EKVDIKAKSRSLSDS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagatactatgaagaagacgccaacgtaacagactcgcccaataggaatgccgctccc
aagttgattcctacaatcaagcttggatcacaagacaatcatgacatgatgtggaacgaa
gatttccatctcaccatcaccaacatggcaaaaaaatacggggctatatacgccttggaa
acaggcaaaacaacactaatcgcgttaaatgatcacaacgctgttcgtgaagcattggtc
aatcaaagcgatgtatttaacattcgagcggatcttgagattcttcaggttgcgccacaa
aagcacttcttagaattagaagcaggagagctgtggagcctgcatagaaaaacctttgca
acggcaatgcgcgactacttccgcgatcgttgggatacgatggatcagtggctggtcaca
gaaatagatgacatcgaggccgcttggaaaagccaaggtgatcaagccgtatttgatcca
aatcgcgacatttcaatcaagctggccagcttcttacacagagtcatgtttgaccgtcgc
ttcggtgaattcgaggagagtgtcttcgatgaaaaaagtctgagttggttgccagcaggc
tttatcaacagtacgcgatatgagctcatgcctgaacacaacaaagaaagctactacgct
cattatggagacgtaatagaaaagtttgcctcaaaccttaacggactcgacgcgtatgtt
tccatgaatgtccttaaggagaaagagtgctacaacaaaggtcaatatcgccacttaacg
gatttcttactaaacgcctgcgacgacattcctaacgacgttaaacaacaagtaggcgca
accgaaaaggaaatcataatcggctctcttactcaggtcgcaggagctggaggcggtgta
ggcgcgtttgctttgcgttggatgctattatatctcgcgagcttccctgaaaagcaaaaa
caagtacacgcagagcttgatcaagttatcggccaaaatgaaacgccacagcaaagtcac
aaaggcgacctgcactacacgcaagcttttattgctgaagtacttcgtcactgttcaatc
acgtccatgccagcctctaactacgctgctagcaaagacacctttattgacggctacttc
gttgcaaaaggaacccctttaatagtgaacaactacggaatgacccgagacgaagcccta
tgggaaaaccctgatgagttcatccctgagcgtttcttagaagcagatggcacctttagc
aaaaagcagcaagcaaagtcattcccattcggaataggtcagcgccgttgcttaggtgag
cttttcggtaagttcctcattaacaccctgttcactcatttagcgcatagatttgagttc
tcccttcctaacaatgaaccgattaatctacgtgctatatcgggtgtatttctggtgcca
gaaaaggtcgatataaaagcgaaaagtcgcagtcttagcgactcataa

DBGET integrated database retrieval system