KEGG   Marinomonas mediterranea: Marme_4095Help
Entry
Marme_4095        CDS       T01449                                 

Definition
monooxygenase (EC:1.14.14.1)
Orthology
K07408  
cytochrome P450, family 1, subfamily A, polypeptide 1 [EC:1.14.14.1]
Organism
mme  Marinomonas mediterranea
Pathway
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mme00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4532007..4533494
Genome map
AA seq 495 aa AA seqDB search
MRYYEEDANVTDSPNRNAAPKLIPTIKLGSQDNHDMMWNEDFHLTITNMAKKYGAIYALE
TGKTTLIALNDHNAVREALVNQSDVFNIRADLEILQVAPQKHFLELEAGELWSLHRKTFA
TAMRDYFRDRWDTMDQWLVTEIDDIEAAWKSQGDQAVFDPNRDISIKLASFLHRVMFDRR
FGEFEESVFDEKSLSWLPAGFINSTRYELMPEHNKESYYAHYGDVIEKFASNLNGLDAYV
SMNVLKEKECYNKGQYRHLTDFLLNACDDIPNDVKQQVGATEKEIIIGSLTQVAGAGGGV
GAFALRWMLLYLASFPEKQKQVHAELDQVIGQNETPQQSHKGDLHYTQAFIAEVLRHCSI
TSMPASNYAASKDTFIDGYFVAKGTPLIVNNYGMTRDEALWENPDEFIPERFLEADGTFS
KKQQAKSFPFGIGQRRCLGELFGKFLINTLFTHLAHRFEFSLPNNEPINLRAISGVFLVP
EKVDIKAKSRSLSDS
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagatactatgaagaagacgccaacgtaacagactcgcccaataggaatgccgctccc
aagttgattcctacaatcaagcttggatcacaagacaatcatgacatgatgtggaacgaa
gatttccatctcaccatcaccaacatggcaaaaaaatacggggctatatacgccttggaa
acaggcaaaacaacactaatcgcgttaaatgatcacaacgctgttcgtgaagcattggtc
aatcaaagcgatgtatttaacattcgagcggatcttgagattcttcaggttgcgccacaa
aagcacttcttagaattagaagcaggagagctgtggagcctgcatagaaaaacctttgca
acggcaatgcgcgactacttccgcgatcgttgggatacgatggatcagtggctggtcaca
gaaatagatgacatcgaggccgcttggaaaagccaaggtgatcaagccgtatttgatcca
aatcgcgacatttcaatcaagctggccagcttcttacacagagtcatgtttgaccgtcgc
ttcggtgaattcgaggagagtgtcttcgatgaaaaaagtctgagttggttgccagcaggc
tttatcaacagtacgcgatatgagctcatgcctgaacacaacaaagaaagctactacgct
cattatggagacgtaatagaaaagtttgcctcaaaccttaacggactcgacgcgtatgtt
tccatgaatgtccttaaggagaaagagtgctacaacaaaggtcaatatcgccacttaacg
gatttcttactaaacgcctgcgacgacattcctaacgacgttaaacaacaagtaggcgca
accgaaaaggaaatcataatcggctctcttactcaggtcgcaggagctggaggcggtgta
ggcgcgtttgctttgcgttggatgctattatatctcgcgagcttccctgaaaagcaaaaa
caagtacacgcagagcttgatcaagttatcggccaaaatgaaacgccacagcaaagtcac
aaaggcgacctgcactacacgcaagcttttattgctgaagtacttcgtcactgttcaatc
acgtccatgccagcctctaactacgctgctagcaaagacacctttattgacggctacttc
gttgcaaaaggaacccctttaatagtgaacaactacggaatgacccgagacgaagcccta
tgggaaaaccctgatgagttcatccctgagcgtttcttagaagcagatggcacctttagc
aaaaagcagcaagcaaagtcattcccattcggaataggtcagcgccgttgcttaggtgag
cttttcggtaagttcctcattaacaccctgttcactcatttagcgcatagatttgagttc
tcccttcctaacaatgaaccgattaatctacgtgctatatcgggtgtatttctggtgcca
gaaaaggtcgatataaaagcgaaaagtcgcagtcttagcgactcataa

DBGET integrated database retrieval system