KEGG   Marinomonas mediterranea: Marme_4126Help
Entry
Marme_4126        CDS       T01449                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mme  Marinomonas mediterranea
Pathway
mme00230  Purine metabolism
mme01100  Metabolic pathways
Module
mme_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Marme_4126
Enzymes [BR:mme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Marme_4126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 RsgA_GTPase CPT AAA_22 AAA_18 MMR_HSR1 ABC_tran Viral_helicase1 MbeD_MobD AAA
Motif
Other DBs
NCBI-ProteinID: ADZ93326
JGI: Marme_4126
UniProt: F2K0X7
Position
4571685..4572311
Genome map
AA seq 208 aa AA seqDB search
MAKKHLGNLFILSAPSGAGKSSLYKALLAEDSMVRISVSHTTRAAREGEQDGREYHFTNI
DHFLDMIAEEAFFEHAQVFDNYYGTSKQAIFDMLEQGLDVILEIDWQGARQIREQYSDAI
GIFILPPSIETLESRLRGRGTDSDEVIARRMSKAVDEISHYDEYDFVIVNDDFDDAFTQL
RTIFTAMRSKTAVMKEKHTNLINDLLSL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaagcacctaggcaatttatttattctttctgcaccttctggtgcgggtaaa
tcttctctgtataaagcgttgcttgcagaggacagtatggttcgaatttcagtttctcat
acgacacgagcagcgcgtgaaggcgagcaagacgggcgtgagtaccatttcaccaatatc
gatcatttcttggatatgatcgcagaggaagcctttttcgaacacgcccaagtatttgat
aactattacggaacgtccaagcaagccattttcgatatgctcgaacaagggctggatgtg
attcttgaaattgattggcaaggcgctcgacaaatcagagagcaatactcagatgccatt
ggcattttcattttgccgccgtccattgaaacacttgaaagccgattacgaggtcgcgga
accgacagtgacgaggtcattgctcgccgcatgtcgaaggccgtcgatgaaatcagtcac
tatgatgaatacgatttcgtgattgtgaacgacgatttcgatgacgcatttactcagctt
cggacaattttcaccgcaatgcgctccaaaacagcggtaatgaaggaaaaacatacaaat
ctgatcaatgatctcttgtcattataa

DBGET integrated database retrieval system