KEGG   Martelella mediterranea: Mame_03031Help
Entry
Mame_03031        CDS       T04757                                 

Gene name
phbA_2
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mmed  Martelella mediterranea
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mmed00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mame_03031 (phbA_2)
   00630 Glyoxylate and dicarboxylate metabolism
    Mame_03031 (phbA_2)
   00640 Propanoate metabolism
    Mame_03031 (phbA_2)
   00650 Butanoate metabolism
    Mame_03031 (phbA_2)
  Lipid metabolism
   00071 Fatty acid degradation
    Mame_03031 (phbA_2)
   00072 Synthesis and degradation of ketone bodies
    Mame_03031 (phbA_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mame_03031 (phbA_2)
   00310 Lysine degradation
    Mame_03031 (phbA_2)
   00380 Tryptophan metabolism
    Mame_03031 (phbA_2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mame_03031 (phbA_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mame_03031 (phbA_2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mame_03031 (phbA_2)
Enzymes [BR:mmed01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mame_03031 (phbA_2)
Exosome [BR:mmed04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mame_03031 (phbA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3250111..3251286
Genome map
AA seq 391 aa AA seqDB search
MHDIVIVAAARTAIGAFMKGLAAMPAHELGSIAITEALSRCGVSPAEVDEIILGQVLTAG
AGQNPARQAAMKAGIPDTSTAFGINQVCGSGLRAVALGMQQIALGDARVIVAGGQESMSL
SAHCAHLRGGVKMGNASLVDTMVSDGLTDAFGGMQMGITAENVAREYGIDRAAQDAFAVA
SHRKAAAAQQAGRFAEEIVPVTVRARKTETVIDTDEQIRADASEEGLAALRPAFEKDGTV
TAGNASGLNDGAAALVLMHADEAARRGLAPLARIASWATAGVDPAIMGIAPVSASRKALE
KAGWSAADLDLVEANEAFAAQACAVNAQMGWDPDKVNVNGGAIALGHPIGASGARVLVTL
LHELKRRDGRKGLATLCIGGGMGVALCVERP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcatgacatcgtcattgtagcggcggcccgcacggccatcggcgccttcatgaaaggc
cttgccgccatgcccgcgcacgagctgggcagcatcgcgatcactgaggccctgtcgcgc
tgcggcgtgagccccgccgaagtcgatgagatcattctcggccaggtgctcaccgcgggc
gccgggcagaacccggcccggcaggcggccatgaaggccggcattcccgacacttcaacg
gcattcggcatcaatcaggtctgcggttccggcctgcgcgccgtcgctctgggcatgcag
cagatcgctctcggcgacgcccgcgttattgttgccggtggccaggaatcgatgtcgctt
tccgcccattgcgcgcatctgcgcggcggcgtgaagatgggcaatgcatcgctggtcgac
accatggtctccgatgggctgaccgatgcatttggcggcatgcaaatgggcatcaccgcg
gaaaacgtcgccagagaatacgggatcgaccgcgccgcgcaggacgcctttgctgtcgca
agccatcgcaaggccgcggccgcgcaacaggccggccggtttgccgaggaaatcgttccc
gtcaccgttcgcgcccgcaagaccgaaacggtgatcgacaccgacgaacagatccgcgcc
gatgccagcgaagaaggacttgccgcccttcgcccggcgttcgaaaaggatggcaccgtc
accgccggcaatgcctcgggtctcaatgacggcgcggcggcgctggtgctgatgcatgcg
gatgaggccgcaaggcgcggccttgcgccgctggcgcggatcgcgtcctgggcaacggcc
ggggtcgatccggcgatcatgggcattgcgcccgtctcagcctcgcgcaaggcgctggaa
aaggcgggctggtcggccgccgacctcgatctggtggaggccaatgaagcattcgcggcc
caggcctgcgccgtcaacgcgcagatgggctgggacccggacaaggtcaacgtcaatggc
ggcgcgatcgcgcttggtcatccgatcggcgcatcgggcgcgcgtgttctggtgacgctg
cttcacgagctgaaacgccgcgatggccgcaagggcctggccacgctatgcatcggcggc
ggcatgggcgtcgcgctatgcgtggaacgtccctga

DBGET integrated database retrieval system