KEGG   Methanothermobacter marburgensis: MTBMA_c00590Help
Entry
MTBMA_c00590      CDS       T01297                                 

Gene name
trpB1
Definition
(GenBank) predicted tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTBMA_c00590 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTBMA_c00590 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTBMA_c00590 (trpB1)
Enzymes [BR:mmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTBMA_c00590 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(54533..55819)
Genome map
AA seq 428 aa AA seqDB search
MNKIVLDENEIPKKWYNINPDLPSPLPEPRNPEGGENIENLPRVFSRGVLEQEMSMERWI
KIPREVRDVYKMIGRPTPLFRAKGLEEMLDTPARIYYKREDYSPTGSHKLNTAIAQAYYA
REDGAERLTTETGAGQWGTALSLACSLMDLQCKVYMVRVSFNQKPFRKTIMQLYGGEVVP
SPSDHTEFGRKILSEDPEHPGSLGIAISEAMEEALQYENVYYSLGSVLNHVLLHQTVIGL
ETQKQLEIAGETPDVMIGCVGGGSNFGGAVFPFIKDKLDGKLDCEFIAAEPRSCPTLTQG
EYRYDFGDTAGMTPLLKMYTLGHDFVPPSVHAGGLRYHGMSPQVALLVKEGIIKARAVEQ
HKIFESGVKFAKAEGVVPAPETCHAISVAMDEARKCRETGEEKTIVVSFSGHGLLDLKGY
GDYLEGKI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattgttcttgacgaaaatgaaataccaaaaaaatggtacaacatcaacccg
gacctgccatcaccactaccagaacccagaaaccctgagggcggagagaacatagagaac
cttccaagggtgttctcaaggggggttcttgagcaggagatgtcaatggagcgctggata
aagatcccccgtgaggtcagagatgtctacaagatgatcggaagacccaccccactcttt
cgagcaaagggccttgaggagatgcttgacacccccgccaggatatactacaagagggag
gattattcacccacaggaagccacaagctcaataccgcgatagcacaggcatactatgcc
cgtgaagatggagctgaaaggctcacaacagaaacaggcgctggacagtggggaaccgcc
ctctcacttgcatgttcactcatggacctccagtgcaaggtctacatggtcagggtttcc
ttcaaccagaagcccttcaggaaaacaataatgcagctctatggtggcgaggttgtccca
tcaccaagtgaccataccgaattcggaaggaaaatactcagtgaggacccagaacacccg
ggctcccttggtatagccatatcagaggccatggaggaggccctccagtatgaaaacgtt
tactactcccttggaagcgtcctcaaccacgttctgctacaccagaccgtgataggtctt
gaaacacagaaacagctggaaatagcaggtgaaacacctgacgtcatgataggatgtgtg
ggtgggggcagcaactttggcggggcggtttttccattcataaaggataaacttgatggt
aagctcgactgtgaattcatagcagctgaaccaagatcctgcccgaccctcacccaggga
gaataccggtatgactttggtgacactgctggtatgacaccactcctcaagatgtacaca
ctaggccacgactttgtacccccatctgtacatgcaggcggtctgaggtaccatggaatg
tcaccgcaggttgcactgctggtgaaggagggcatcatcaaggcccgggccgtagaacag
cataaaatatttgagagcggtgttaaatttgcaaaggccgagggggttgttcctgcacca
gagacctgccacgccataagtgttgccatggatgaggccagaaagtgcagagagaccggt
gaggaaaaaaccatagtcgtaagcttctctggccacgggctcctggacctcaagggttac
ggggactatcttgagggcaaaatctga

DBGET integrated database retrieval system