KEGG   Methanothermobacter marburgensis: MTBMA_c00590Help
Entry
MTBMA_c00590      CDS       T01297                                 

Gene name
trpB1
Definition
tryptophan synthase, beta chain (EC:4.2.1.20)
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTBMA_c00590 (trpB1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTBMA_c00590 (trpB1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTBMA_c00590 (trpB1)
Enzymes [BR:mmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTBMA_c00590 (trpB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(54533..55819)
Genome map
AA seq 428 aa AA seqDB search
MNKIVLDENEIPKKWYNINPDLPSPLPEPRNPEGGENIENLPRVFSRGVLEQEMSMERWI
KIPREVRDVYKMIGRPTPLFRAKGLEEMLDTPARIYYKREDYSPTGSHKLNTAIAQAYYA
REDGAERLTTETGAGQWGTALSLACSLMDLQCKVYMVRVSFNQKPFRKTIMQLYGGEVVP
SPSDHTEFGRKILSEDPEHPGSLGIAISEAMEEALQYENVYYSLGSVLNHVLLHQTVIGL
ETQKQLEIAGETPDVMIGCVGGGSNFGGAVFPFIKDKLDGKLDCEFIAAEPRSCPTLTQG
EYRYDFGDTAGMTPLLKMYTLGHDFVPPSVHAGGLRYHGMSPQVALLVKEGIIKARAVEQ
HKIFESGVKFAKAEGVVPAPETCHAISVAMDEARKCRETGEEKTIVVSFSGHGLLDLKGY
GDYLEGKI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattgttcttgacgaaaatgaaataccaaaaaaatggtacaacatcaacccg
gacctgccatcaccactaccagaacccagaaaccctgagggcggagagaacatagagaac
cttccaagggtgttctcaaggggggttcttgagcaggagatgtcaatggagcgctggata
aagatcccccgtgaggtcagagatgtctacaagatgatcggaagacccaccccactcttt
cgagcaaagggccttgaggagatgcttgacacccccgccaggatatactacaagagggag
gattattcacccacaggaagccacaagctcaataccgcgatagcacaggcatactatgcc
cgtgaagatggagctgaaaggctcacaacagaaacaggcgctggacagtggggaaccgcc
ctctcacttgcatgttcactcatggacctccagtgcaaggtctacatggtcagggtttcc
ttcaaccagaagcccttcaggaaaacaataatgcagctctatggtggcgaggttgtccca
tcaccaagtgaccataccgaattcggaaggaaaatactcagtgaggacccagaacacccg
ggctcccttggtatagccatatcagaggccatggaggaggccctccagtatgaaaacgtt
tactactcccttggaagcgtcctcaaccacgttctgctacaccagaccgtgataggtctt
gaaacacagaaacagctggaaatagcaggtgaaacacctgacgtcatgataggatgtgtg
ggtgggggcagcaactttggcggggcggtttttccattcataaaggataaacttgatggt
aagctcgactgtgaattcatagcagctgaaccaagatcctgcccgaccctcacccaggga
gaataccggtatgactttggtgacactgctggtatgacaccactcctcaagatgtacaca
ctaggccacgactttgtacccccatctgtacatgcaggcggtctgaggtaccatggaatg
tcaccgcaggttgcactgctggtgaaggagggcatcatcaaggcccgggccgtagaacag
cataaaatatttgagagcggtgttaaatttgcaaaggccgagggggttgttcctgcacca
gagacctgccacgccataagtgttgccatggatgaggccagaaagtgcagagagaccggt
gaggaaaaaaccatagtcgtaagcttctctggccacgggctcctggacctcaagggttac
ggggactatcttgagggcaaaatctga

DBGET integrated database retrieval system