KEGG   Methanothermobacter marburgensis: MTBMA_c01390Help
Entry
MTBMA_c01390      CDS       T01297                                 

Gene name
fwdH
Definition
(GenBank) tungsten formylmethanofuran dehydrogenase, subunit H
  KO
K00204  4Fe-4S ferredoxin
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00680  Methane metabolism
mmg01100  Metabolic pathways
mmg01120  Microbial metabolism in diverse environments
mmg01200  Carbon metabolism
Module
mmg_M00567  Methanogenesis, CO2 => methane
mmg_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MTBMA_c01390 (fwdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_21 HTH_3 HTH_23 Fer4_9 Fer4_16 HTH_38 HTH_28 Fer4_17 Fer4_10 HTH_24 HTH_31 HTH_5 HTH_7 Sigma70_r4_2 HTH_37 HTH_19 Fer4_4 HTH_29 Fer4_6 Fer4_2 DUF739 TnsD HTH_40 Terminase_5 HTH_IclR CENP-B_N NUMOD1 GerE MarR RepB Fer4_8 Sigma70_r4 Phage_NinH Fer4_3 YdaS_antitoxin HTH_36 DUF2285 Fer4_22 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ADL57748
UniProt: D9PU50
Position
145655..146131
Genome map
AA seq 158 aa AA seqDB search
MPKHIVSGLKYIAAVNLTKQGHSQREIAKALKINRSTVSHYLNGRNLSWRSIEIARVITE
MCPRDFLLLTHSLTQNTEMTRTIVKTCQQREFKGNVRNSCIGCGLCVDTCLRKAITLRDL
KAHVDSEWCCGCLICVDMCPTDSIEIKEVEIDGNDRSN
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaacatatagtttctggactcaaatacatagcagccgtaaacctaacaaaacag
ggccattcacagagagagatagccaaagctctgaagataaacagatcaactgtttctcac
tacctcaacgggagaaacctctcatggaggtcaatagagattgcaagggtaataacagag
atgtgtccaagggatttccttcttctcacccactcccttacacagaacacagagatgaca
aggacgatagtgaagacatgccagcagagggaattcaagggaaacgtcaggaactcatgt
attgggtgcgggctatgtgtggacacatgcctcaggaaggccataaccctccgagacctc
aaggcacatgtggattccgaatggtgctgcgggtgtctcatctgtgtggatatgtgtcca
actgattctatagaaataaaggaggtagaaattgatggaaacgaccgaagtaattga

DBGET integrated database retrieval system