KEGG   Methanothermobacter marburgensis: MTBMA_c01390Help
Entry
MTBMA_c01390      CDS       T01297                                 

Gene name
fwdH
Definition
tungsten formylmethanofuran dehydrogenase, subunit H (EC:1.2.99.5)
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mmg  Methanothermobacter marburgensis
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTBMA_c01390 (fwdH)
  Energy metabolism
   00680 Methane metabolism
    MTBMA_c01390 (fwdH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
145655..146131
Genome map
AA seq 158 aa AA seqDB search
MPKHIVSGLKYIAAVNLTKQGHSQREIAKALKINRSTVSHYLNGRNLSWRSIEIARVITE
MCPRDFLLLTHSLTQNTEMTRTIVKTCQQREFKGNVRNSCIGCGLCVDTCLRKAITLRDL
KAHVDSEWCCGCLICVDMCPTDSIEIKEVEIDGNDRSN
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaacatatagtttctggactcaaatacatagcagccgtaaacctaacaaaacag
ggccattcacagagagagatagccaaagctctgaagataaacagatcaactgtttctcac
tacctcaacgggagaaacctctcatggaggtcaatagagattgcaagggtaataacagag
atgtgtccaagggatttccttcttctcacccactcccttacacagaacacagagatgaca
aggacgatagtgaagacatgccagcagagggaattcaagggaaacgtcaggaactcatgt
attgggtgcgggctatgtgtggacacatgcctcaggaaggccataaccctccgagacctc
aaggcacatgtggattccgaatggtgctgcgggtgtctcatctgtgtggatatgtgtcca
actgattctatagaaataaaggaggtagaaattgatggaaacgaccgaagtaattga

DBGET integrated database retrieval system