KEGG   Methanothermobacter marburgensis: MTBMA_c01700Help
Entry
MTBMA_c01700      CDS       T01297                                 

Definition
(GenBank) predicted phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00010  Glycolysis / Gluconeogenesis
mmg00030  Pentose phosphate pathway
mmg00051  Fructose and mannose metabolism
mmg00052  Galactose metabolism
mmg00230  Purine metabolism
mmg00500  Starch and sucrose metabolism
mmg00520  Amino sugar and nucleotide sugar metabolism
mmg00521  Streptomycin biosynthesis
mmg01100  Metabolic pathways
mmg01110  Biosynthesis of secondary metabolites
mmg01120  Microbial metabolism in diverse environments
mmg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c01700
   00030 Pentose phosphate pathway
    MTBMA_c01700
   00051 Fructose and mannose metabolism
    MTBMA_c01700
   00052 Galactose metabolism
    MTBMA_c01700
   00500 Starch and sucrose metabolism
    MTBMA_c01700
   00520 Amino sugar and nucleotide sugar metabolism
    MTBMA_c01700
  Nucleotide metabolism
   00230 Purine metabolism
    MTBMA_c01700
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MTBMA_c01700
Enzymes [BR:mmg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MTBMA_c01700
    5.4.2.8  phosphomannomutase
     MTBMA_c01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV Methyltransf_23 TrbI_Ftype
Motif
Other DBs
NCBI-ProteinID: ADL57779
UniProt: D9PU81
Position
175588..176961
Genome map
AA seq 457 aa AA seqDB search
MKRLFGTFGVRRLANEVLTPEFASKLAAAYGSIVDGKIAVGGDTRTSTVMIKNAVISGLL
SSGCDVVDLGILPTPAVQYAVRNYYDGGVIVTASHNPPEYNGIKFVDGDGIGIPDDMEEE
IEDIFFQKKFKRASWNEIGHLTVNQGIIDEYQEEVIRRVDAEAIRKRNFRVVVDCGCGAG
SYTMPYILRKLGCSVVTLNSQPDGFFPGRDPEPVPENLSELMETVRSTGADLGIAHDGDA
DRTICIDEKGEFVLGDRTFALVEKRMLQENGGGIIVTTVATSSAIYDVAEENNGEVIATA
VGDLLVARKLKETGGLFGGEENGGLIFPDFVYGRDAALTAAKILEIMAHEGRPLSELVSE
LPSYYSEKKKVKCPDEIKGDVMKLVAEMVSTEPGVRDIDTTDGVKIFRDSGWVIIRPSGT
EPIFRCFAESDTQKNATKMAEWGISLVEEAIEKLGKV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggctcttcggtacatttggtgttaggagacttgcaaatgaggttttaacccct
gaattcgcatctaaacttgcagcagcatatggttccattgtagatggaaaaattgctgtt
ggaggagatacaaggacatccactgtcatgataaaaaatgctgttatatccggccttcta
tcaagtggatgtgatgttgttgaccttgggatactgccgacaccagcggtccagtatgcg
gtgaggaattactatgatgggggtgttatcgtaaccgcttcccacaaccccccagagtac
aatgggataaaattcgttgacggtgacggtatagggatccctgatgatatggaggaggaa
atagaggatatattcttccagaaaaaatttaagagggcttcatggaatgagataggccat
ctaacagtcaatcagggcataatagatgagtatcaggaggaggttataaggagggtcgat
gcagaggccatcagaaagagaaacttcagggtggtggttgactgtggctgcggcgctgga
tcctacacaatgccatacatcctcaggaaactgggctgcagtgttgtaacccttaattcc
cagcctgatgggtttttccctggtcgtgaccctgaacctgtccctgagaacctttctgag
ctcatggagactgtcagatcaaccggggctgatctggggatagcccatgatggcgacgcc
gatagaacaatatgtatagatgagaagggcgaattcgtcctcggtgataggacctttgcc
cttgttgagaagaggatgctccaggagaacggcggcggaataatagttacgacagtcgcg
acatcctcagcaatatacgacgtggcagaggagaacaacggtgaggtgattgcaaccgct
gtgggggacctccttgtggccagaaaacttaaagagacagggggtctgtttgggggcgag
gagaacggtggtctgatattccctgactttgtatatggaagggacgctgcccttacagcc
gcaaaaatccttgagataatggcacatgaaggaaggcccctctctgaacttgtgtcagag
cttccatcatattactccgagaaaaagaaggtaaaatgtcccgatgaaatcaagggggat
gtcatgaaactggtggctgaaatggtgagcactgaacctggtgtgagggatatagataca
accgatggcgttaaaatcttcagggacagtggttgggttataataaggccttcaggtaca
gaaccaatattcagatgctttgcagagtcagacacccagaaaaatgccactaaaatggct
gaatggggaatatccctggtggaagaggccattgagaaactcgggaaggtctag

DBGET integrated database retrieval system