KEGG   Methanothermobacter marburgensis: MTBMA_c01700Help
Entry
MTBMA_c01700      CDS       T01297                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c01700
   00030 Pentose phosphate pathway
    MTBMA_c01700
   00051 Fructose and mannose metabolism
    MTBMA_c01700
   00052 Galactose metabolism
    MTBMA_c01700
   00500 Starch and sucrose metabolism
    MTBMA_c01700
   00520 Amino sugar and nucleotide sugar metabolism
    MTBMA_c01700
  Nucleotide metabolism
   00230 Purine metabolism
    MTBMA_c01700
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MTBMA_c01700
Enzymes [BR:mmg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     MTBMA_c01700
    5.4.2.8  phosphomannomutase
     MTBMA_c01700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
175588..176961
Genome map
AA seq 457 aa AA seqDB search
MKRLFGTFGVRRLANEVLTPEFASKLAAAYGSIVDGKIAVGGDTRTSTVMIKNAVISGLL
SSGCDVVDLGILPTPAVQYAVRNYYDGGVIVTASHNPPEYNGIKFVDGDGIGIPDDMEEE
IEDIFFQKKFKRASWNEIGHLTVNQGIIDEYQEEVIRRVDAEAIRKRNFRVVVDCGCGAG
SYTMPYILRKLGCSVVTLNSQPDGFFPGRDPEPVPENLSELMETVRSTGADLGIAHDGDA
DRTICIDEKGEFVLGDRTFALVEKRMLQENGGGIIVTTVATSSAIYDVAEENNGEVIATA
VGDLLVARKLKETGGLFGGEENGGLIFPDFVYGRDAALTAAKILEIMAHEGRPLSELVSE
LPSYYSEKKKVKCPDEIKGDVMKLVAEMVSTEPGVRDIDTTDGVKIFRDSGWVIIRPSGT
EPIFRCFAESDTQKNATKMAEWGISLVEEAIEKLGKV
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaagaggctcttcggtacatttggtgttaggagacttgcaaatgaggttttaacccct
gaattcgcatctaaacttgcagcagcatatggttccattgtagatggaaaaattgctgtt
ggaggagatacaaggacatccactgtcatgataaaaaatgctgttatatccggccttcta
tcaagtggatgtgatgttgttgaccttgggatactgccgacaccagcggtccagtatgcg
gtgaggaattactatgatgggggtgttatcgtaaccgcttcccacaaccccccagagtac
aatgggataaaattcgttgacggtgacggtatagggatccctgatgatatggaggaggaa
atagaggatatattcttccagaaaaaatttaagagggcttcatggaatgagataggccat
ctaacagtcaatcagggcataatagatgagtatcaggaggaggttataaggagggtcgat
gcagaggccatcagaaagagaaacttcagggtggtggttgactgtggctgcggcgctgga
tcctacacaatgccatacatcctcaggaaactgggctgcagtgttgtaacccttaattcc
cagcctgatgggtttttccctggtcgtgaccctgaacctgtccctgagaacctttctgag
ctcatggagactgtcagatcaaccggggctgatctggggatagcccatgatggcgacgcc
gatagaacaatatgtatagatgagaagggcgaattcgtcctcggtgataggacctttgcc
cttgttgagaagaggatgctccaggagaacggcggcggaataatagttacgacagtcgcg
acatcctcagcaatatacgacgtggcagaggagaacaacggtgaggtgattgcaaccgct
gtgggggacctccttgtggccagaaaacttaaagagacagggggtctgtttgggggcgag
gagaacggtggtctgatattccctgactttgtatatggaagggacgctgcccttacagcc
gcaaaaatccttgagataatggcacatgaaggaaggcccctctctgaacttgtgtcagag
cttccatcatattactccgagaaaaagaaggtaaaatgtcccgatgaaatcaagggggat
gtcatgaaactggtggctgaaatggtgagcactgaacctggtgtgagggatatagataca
accgatggcgttaaaatcttcagggacagtggttgggttataataaggccttcaggtaca
gaaccaatattcagatgctttgcagagtcagacacccagaaaaatgccactaaaatggct
gaatggggaatatccctggtggaagaggccattgagaaactcgggaaggtctag

DBGET integrated database retrieval system