KEGG   Methanothermobacter marburgensis: MTBMA_c01900Help
Entry
MTBMA_c01900      CDS       T01297                                 

Gene name
acsA1
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mmg01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmg00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mmg00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mmg00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:mmg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
194946..196907
Genome map
AA seq 653 aa AA seqDB search
MSGQLDSLLKEERIFNPDDETVRNSNIRIWMDKHGIGDYDELLERARSDPEWFWDEMASE
LEWFSPYERVLEWEPPHARWFTGGRFNITYNALDRHVAGPEKNRVAYIWEGEDGSVRKLT
YYDLYREVNRLANALKGMGVRKGDRVSIYLPMVPELPVAMLACARIGAVHSVVFSGFWAK
AFRERAADAEAKVAITADAFYRRGKVIRLKETLDMVADDIPSLEKVIVVDRLGEDVNMVE
GRDVRWEDALEGMSDECPCEELDPEDPLFILYTSGTTGKPKGVVHTHGGYAVGVSSTYRF
VFDVKERDIWWCAADIGWITGHSYIVYAPLIEGSTSVMYEGAPDYPDPGRIWSMIERYGV
TIFYTAPTTIRLFMKYGNKWPEKYDLSTLRLLGSVGEPINPEAWMWYYRTIGGGRCPVMD
TWWQTETGMHMITPLPVTPLKPGSAGKPFPTVVADVVDDNGESIRGSGGHLVIRTPWPAM
FRTLFREPERYVEAYWSTFPGVYLSGDVARIDEDGYFWIQGREDDVLNVAGHRISTAEVE
SALVSHPDVVEAAVVGKPDILKGEEIAAFVTLRGTVKPAPRLKGVLREHVRREIGPIASP
SYIEFVEDLPKTRSGKIMRRVIKALIRGEDTGDLSTLSNPESVKMLEERLQTI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcagctagattctctccttaaggaggaacgaattttcaatccagatgatgag
acagttagaaacagcaatataaggatctggatggataaacatggcataggggattatgat
gagctccttgagagggcaaggtcagatcctgaatggttctgggatgaaatggcatctgaa
cttgaatggttcagtccatacgagagggtccttgaatgggaaccaccccatgccagatgg
ttcacaggcggaaggttcaatataacctacaatgcacttgacaggcacgtggctggccct
gaaaagaacagggtcgcctatatatgggagggtgaggatggtagcgtcagaaaactcacc
tactatgacctctaccgtgaggttaaccgtcttgccaatgcactgaagggcatgggtgtc
aggaagggggaccgtgtgagcatctaccttcccatggtaccggagcttccggttgcgatg
ctggcatgcgcaaggataggggccgttcacagcgtcgtattcagcggtttctgggccaag
gcgttccgtgagagggctgcagatgcagaggcaaaggttgcaataactgcagatgcattc
taccggaggggtaaggtaataaggctcaaggagacccttgacatggtggcagatgacatt
ccatcacttgagaaggtaatagtcgttgacaggctcggggaggacgtgaacatggttgag
gggcgggatgtgcgctgggaggatgcgcttgagggaatgagtgatgaatgcccctgtgag
gagctcgaccctgaggacccccttttcatactctacacatcgggcaccacaggaaaaccc
aaaggggtggtgcacacacatgggggctacgcagttggtgtaagttccacctaccgcttt
gtatttgatgtaaaggaaagggacatatggtggtgtgcagcggatatagggtggataaca
ggtcacagctacatagtctacgcccccctcattgagggttcaacatcggttatgtatgag
ggggcccctgattaccctgaccctggaaggatatggagcatgattgaaaggtacggtgtg
accatattctacaccgcccccacaaccatcaggctcttcatgaagtacgggaacaagtgg
cctgaaaagtatgacctcagcaccctcaggctccttggatccgtgggtgaacccataaac
cctgaggcatggatgtggtactacaggacgattggtggtggcagatgtccagtgatggat
acctggtggcagacagagaccgggatgcacatgataacaccccttcctgtaacaccactc
aagccggggtctgcaggaaagccctttcccaccgtggtggctgatgtggttgatgataac
ggtgagagcatacgtggaagcggggggcacctggttataaggacaccctggcctgcgatg
ttcaggacactgttcagggaacctgagaggtatgtggaggcatactggagcaccttcccg
ggggtttacctcagcggggatgttgcaaggatagacgaggatggctacttctggatacag
ggaagggaggatgatgtcctcaatgtcgcaggtcacaggataagcaccgcagaggttgaa
tcggcccttgtaagccaccctgacgttgttgaggcagcggtggtcggaaaacctgatata
ctgaagggtgaggagatagcggcattcgtgacactcaggggcaccgtgaagccggcacca
cgcctcaagggcgttctgagggagcacgtcaggagggaaatagggccaatagcaagtccg
agttacattgaattcgttgaggacctgccaaaaacacgttcaggtaagataatgaggagg
gttataaaggcccttataaggggtgaagacaccggtgatctgagcacactctcaaacccc
gagtctgtgaagatgcttgaggagaggcttcagacaatttaa

DBGET integrated database retrieval system