KEGG   Methanothermobacter marburgensis: MTBMA_c01900Help
Entry
MTBMA_c01900      CDS       T01297                                 

Gene name
acsA1
Definition
(GenBank) predicted acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00010  Glycolysis / Gluconeogenesis
mmg00620  Pyruvate metabolism
mmg00640  Propanoate metabolism
mmg00680  Methane metabolism
mmg00720  Carbon fixation pathways in prokaryotes
mmg01100  Metabolic pathways
mmg01110  Biosynthesis of secondary metabolites
mmg01120  Microbial metabolism in diverse environments
mmg01130  Biosynthesis of antibiotics
mmg01200  Carbon metabolism
Module
mmg_M00357  Methanogenesis, acetate => methane
mmg_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c01900 (acsA1)
   00620 Pyruvate metabolism
    MTBMA_c01900 (acsA1)
   00640 Propanoate metabolism
    MTBMA_c01900 (acsA1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTBMA_c01900 (acsA1)
   00680 Methane metabolism
    MTBMA_c01900 (acsA1)
Enzymes [BR:mmg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MTBMA_c01900 (acsA1)
Lipid biosynthesis proteins [BR:mmg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MTBMA_c01900 (acsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADL57799
UniProt: D9PUA1
Position
194946..196907
Genome map
AA seq 653 aa AA seqDB search
MSGQLDSLLKEERIFNPDDETVRNSNIRIWMDKHGIGDYDELLERARSDPEWFWDEMASE
LEWFSPYERVLEWEPPHARWFTGGRFNITYNALDRHVAGPEKNRVAYIWEGEDGSVRKLT
YYDLYREVNRLANALKGMGVRKGDRVSIYLPMVPELPVAMLACARIGAVHSVVFSGFWAK
AFRERAADAEAKVAITADAFYRRGKVIRLKETLDMVADDIPSLEKVIVVDRLGEDVNMVE
GRDVRWEDALEGMSDECPCEELDPEDPLFILYTSGTTGKPKGVVHTHGGYAVGVSSTYRF
VFDVKERDIWWCAADIGWITGHSYIVYAPLIEGSTSVMYEGAPDYPDPGRIWSMIERYGV
TIFYTAPTTIRLFMKYGNKWPEKYDLSTLRLLGSVGEPINPEAWMWYYRTIGGGRCPVMD
TWWQTETGMHMITPLPVTPLKPGSAGKPFPTVVADVVDDNGESIRGSGGHLVIRTPWPAM
FRTLFREPERYVEAYWSTFPGVYLSGDVARIDEDGYFWIQGREDDVLNVAGHRISTAEVE
SALVSHPDVVEAAVVGKPDILKGEEIAAFVTLRGTVKPAPRLKGVLREHVRREIGPIASP
SYIEFVEDLPKTRSGKIMRRVIKALIRGEDTGDLSTLSNPESVKMLEERLQTI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggcagctagattctctccttaaggaggaacgaattttcaatccagatgatgag
acagttagaaacagcaatataaggatctggatggataaacatggcataggggattatgat
gagctccttgagagggcaaggtcagatcctgaatggttctgggatgaaatggcatctgaa
cttgaatggttcagtccatacgagagggtccttgaatgggaaccaccccatgccagatgg
ttcacaggcggaaggttcaatataacctacaatgcacttgacaggcacgtggctggccct
gaaaagaacagggtcgcctatatatgggagggtgaggatggtagcgtcagaaaactcacc
tactatgacctctaccgtgaggttaaccgtcttgccaatgcactgaagggcatgggtgtc
aggaagggggaccgtgtgagcatctaccttcccatggtaccggagcttccggttgcgatg
ctggcatgcgcaaggataggggccgttcacagcgtcgtattcagcggtttctgggccaag
gcgttccgtgagagggctgcagatgcagaggcaaaggttgcaataactgcagatgcattc
taccggaggggtaaggtaataaggctcaaggagacccttgacatggtggcagatgacatt
ccatcacttgagaaggtaatagtcgttgacaggctcggggaggacgtgaacatggttgag
gggcgggatgtgcgctgggaggatgcgcttgagggaatgagtgatgaatgcccctgtgag
gagctcgaccctgaggacccccttttcatactctacacatcgggcaccacaggaaaaccc
aaaggggtggtgcacacacatgggggctacgcagttggtgtaagttccacctaccgcttt
gtatttgatgtaaaggaaagggacatatggtggtgtgcagcggatatagggtggataaca
ggtcacagctacatagtctacgcccccctcattgagggttcaacatcggttatgtatgag
ggggcccctgattaccctgaccctggaaggatatggagcatgattgaaaggtacggtgtg
accatattctacaccgcccccacaaccatcaggctcttcatgaagtacgggaacaagtgg
cctgaaaagtatgacctcagcaccctcaggctccttggatccgtgggtgaacccataaac
cctgaggcatggatgtggtactacaggacgattggtggtggcagatgtccagtgatggat
acctggtggcagacagagaccgggatgcacatgataacaccccttcctgtaacaccactc
aagccggggtctgcaggaaagccctttcccaccgtggtggctgatgtggttgatgataac
ggtgagagcatacgtggaagcggggggcacctggttataaggacaccctggcctgcgatg
ttcaggacactgttcagggaacctgagaggtatgtggaggcatactggagcaccttcccg
ggggtttacctcagcggggatgttgcaaggatagacgaggatggctacttctggatacag
ggaagggaggatgatgtcctcaatgtcgcaggtcacaggataagcaccgcagaggttgaa
tcggcccttgtaagccaccctgacgttgttgaggcagcggtggtcggaaaacctgatata
ctgaagggtgaggagatagcggcattcgtgacactcaggggcaccgtgaagccggcacca
cgcctcaagggcgttctgagggagcacgtcaggagggaaatagggccaatagcaagtccg
agttacattgaattcgttgaggacctgccaaaaacacgttcaggtaagataatgaggagg
gttataaaggcccttataaggggtgaagacaccggtgatctgagcacactctcaaacccc
gagtctgtgaagatgcttgaggagaggcttcagacaatttaa

DBGET integrated database retrieval system