KEGG   Methanothermobacter marburgensis: MTBMA_c02380Help
Entry
MTBMA_c02380      CDS       T01297                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTBMA_c02380 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTBMA_c02380 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTBMA_c02380 (trpB2)
Enzymes [BR:mmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTBMA_c02380 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
242525..243703
Genome map
AA seq 392 aa AA seqDB search
MIMDGKFGKYGGIFVPELLIPALEELEAAFLHYSKDRRFNEDLEHYLREYAGRPTGLYHA
RNLSEKLGCRVYLKREDMLHTGAHKINNTIGQALLAGYMGKRRLIAETGAGQHGIATAAA
GALFGMDVDVYMGTEDVERQKLNVFRMEISGARVIPVDSGSRTLKDAINQAMRDWISSVE
DTHYLIGSTMGPHPYPTMVKHFQSVIGREAREQILEIEGELPDTIIACVGGGSNAIGIFS
AFLDDDVELIGAEGGGEGIESGNHGATLSAGSEGVLHGSLSYVLQDDDGQINEAHSVSAG
LDYPGVGPEHAYLMETGRAMYEPITDAEALRGFKLLSRCEGIMPALESAHAIACLEKYAS
KPENRGKTVIVNLSGRGDKDMFLAAGLLGVDL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgataatggatggtaaattcggtaaatatgggggaatattcgtgccagaactcctcata
cctgcacttgaggagcttgaggcggcattcctccactacagtaaggataggaggttcaat
gaggacctggaacactacctgagggaatacgcaggaagaccaacaggtttgtaccacgcc
aggaacctctcagagaaacttggatgcagggtctacctcaagagggaggatatgctgcat
acaggggcccataaaataaacaatacaataggccaggcactccttgcagggtatatgggt
aagaggaggctgatagcagagacaggggcagggcagcatggaatagcaactgcagcagca
ggcgccctctttgggatggatgttgatgtctacatgggaaccgaggatgttgagagacag
aaactaaacgtcttcaggatggaaatttcaggtgcaagggtcatacctgttgattcaggt
tcaaggacacttaaggacgccataaaccaggccatgagggactggataagcagcgtggag
gacacccactatctgataggatccaccatggggccccacccataccccaccatggtgaag
cacttccagagcgtcataggaagggaggccagagaacagatacttgaaattgagggtgaa
cttcctgacaccataatagcctgtgttggtggcggtagcaacgccataggtatattctca
gccttcctggacgatgatgttgaactgataggtgcagagggagggggtgaaggtatagag
tcaggaaaccatggggcaaccctatcggctggttcagagggtgtactgcacggttcactt
tcatatgtactccaggatgacgatggacagataaatgaggcccattcggtttcggcgggc
cttgactatcccggggttggcccggagcacgcatacctcatggagaccggaagggcaatg
tatgagcccataaccgacgccgaggccctcaggggcttcaaactcctctcaagatgtgag
ggtataatgccggcgcttgaaagcgcccatgccatagcatgccttgaaaaatacgcctca
aaacctgaaaacaggggaaagactgtcatagttaacctttcaggaaggggagacaaggac
atgttccttgcagcaggccttctgggggtggatctatga

DBGET integrated database retrieval system