KEGG   Methanothermobacter marburgensis: MTBMA_c02390Help
Entry
MTBMA_c02390      CDS       T01297                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00260  Glycine, serine and threonine metabolism
mmg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mmg01100  Metabolic pathways
mmg01110  Biosynthesis of secondary metabolites
mmg01130  Biosynthesis of antibiotics
mmg01230  Biosynthesis of amino acids
Module
mmg_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTBMA_c02390 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTBMA_c02390 (trpA)
Enzymes [BR:mmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTBMA_c02390 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB NMO NanE PEP_mutase BtpA ThiG TMP-TENI IGPS FMN_dh IMPDH DUF561 HMGL-like Dus GDPD
Motif
Other DBs
NCBI-ProteinID: ADL57848
UniProt: P26920
Position
243759..244556
Genome map
AA seq 265 aa AA seqDB search
MNYAEMFSRVEGCAFVPFVVAGDPDMETSVEIIRTLVDAGADALEIGFPFSDPIADGTSV
QEADLRALNSGMTTDDCFRLIERIREFTSVPVGLLVYYNLIYRMGADEFYRRAAEAGVTG
ILAADLPPEEAGDALRAAERYGIDQIFIVAPTTDNQRLKMISEVSSGFHYLVSVMGVTGA
RSRVEESTLELIERVKGAGSLPVMVGFGVSQPEHVRMLADAGADGVIVGSAIIDLISKNL
DDRERMLQEIYEMVRKMKTAAGGSR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgctgaaatgttcagcagggttgagggatgcgcctttgttccatttgtggtt
gcaggggatcctgacatggagacctcagttgaaatcataagaacacttgtggatgccggt
gcagatgcccttgaaataggtttcccattctctgaccccatagcagacggcacaagtgta
caggaggctgatctgagggctttaaattccgggatgaccaccgatgactgtttcaggttg
atagagagaataagggaattcacctcagtaccggtgggtcttctcgtatactacaacctg
atataccgcatgggtgctgatgaattctacaggagggccgccgaggccggtgttacaggt
atccttgccgcggaccttcccccggaggaggccggcgatgccctcagggcggctgaaaga
tatggaattgatcagatattcatagttgcacccacaacagacaatcagcgcctcaaaatg
atctcagaggtttcatcagggttccactaccttgtatcggttatgggtgtcaccggtgca
aggtccagggttgaggagagcacacttgaactcatagagagggttaagggggcaggaagc
cttcctgtgatggtcggctttggtgtttcacagccagaacatgtgagaatgcttgctgac
gcaggtgccgatggtgttatagttggaagtgcaatcatagacctgatatccaaaaatctt
gatgacagggaaaggatgcttcaggagatatacgaaatggtcagaaaaatgaagaccgct
gcaggggggtccagatga

DBGET integrated database retrieval system