KEGG   Methanothermobacter marburgensis: MTBMA_c02390Help
Entry
MTBMA_c02390      CDS       T01297                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTBMA_c02390 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTBMA_c02390 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MTBMA_c02390 (trpA)
Enzymes [BR:mmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MTBMA_c02390 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
243759..244556
Genome map
AA seq 265 aa AA seqDB search
MNYAEMFSRVEGCAFVPFVVAGDPDMETSVEIIRTLVDAGADALEIGFPFSDPIADGTSV
QEADLRALNSGMTTDDCFRLIERIREFTSVPVGLLVYYNLIYRMGADEFYRRAAEAGVTG
ILAADLPPEEAGDALRAAERYGIDQIFIVAPTTDNQRLKMISEVSSGFHYLVSVMGVTGA
RSRVEESTLELIERVKGAGSLPVMVGFGVSQPEHVRMLADAGADGVIVGSAIIDLISKNL
DDRERMLQEIYEMVRKMKTAAGGSR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgctgaaatgttcagcagggttgagggatgcgcctttgttccatttgtggtt
gcaggggatcctgacatggagacctcagttgaaatcataagaacacttgtggatgccggt
gcagatgcccttgaaataggtttcccattctctgaccccatagcagacggcacaagtgta
caggaggctgatctgagggctttaaattccgggatgaccaccgatgactgtttcaggttg
atagagagaataagggaattcacctcagtaccggtgggtcttctcgtatactacaacctg
atataccgcatgggtgctgatgaattctacaggagggccgccgaggccggtgttacaggt
atccttgccgcggaccttcccccggaggaggccggcgatgccctcagggcggctgaaaga
tatggaattgatcagatattcatagttgcacccacaacagacaatcagcgcctcaaaatg
atctcagaggtttcatcagggttccactaccttgtatcggttatgggtgtcaccggtgca
aggtccagggttgaggagagcacacttgaactcatagagagggttaagggggcaggaagc
cttcctgtgatggtcggctttggtgtttcacagccagaacatgtgagaatgcttgctgac
gcaggtgccgatggtgttatagttggaagtgcaatcatagacctgatatccaaaaatctt
gatgacagggaaaggatgcttcaggagatatacgaaatggtcagaaaaatgaagaccgct
gcaggggggtccagatga

DBGET integrated database retrieval system