KEGG   Methanothermobacter marburgensis: MTBMA_c02650Help
Entry
MTBMA_c02650      CDS       T01297                                 

Definition
fructose 1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTBMA_c02650
   01230 Biosynthesis of amino acids
    MTBMA_c02650
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c02650
   00030 Pentose phosphate pathway
    MTBMA_c02650
   00051 Fructose and mannose metabolism
    MTBMA_c02650
  Energy metabolism
   00680 Methane metabolism
    MTBMA_c02650
Enzymes [BR:mmg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MTBMA_c02650
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MTBMA_c02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265274..266371
Genome map
AA seq 365 aa AA seqDB search
MKTTISVIKADVGSVAGHAVAHEALKKKCDEILAEARDTGILEDYYITNCGDDIDLIMTH
RNGEENEEVHQTAWNAFREATEVARGLKLYGAGQDLLSDTFSGNIKGMGPGCAEMEFKER
PSDPVIIFCCDKTEPGAFNLPLFRMFADPFNTAGLVIDPTLHNGYEFEVFDVVEHKKVTM
ACPDEMYDLLALLGSISRYVIKKIHRRDDGEIAASVSTERLNLMAGKYIGKDDPVAIVRA
QSGFPAAGEVVEPFAFPHLVGGWMRGSHNGPLMPVAQRDATPVRFDGPPRVIGLGFQIAD
CKLVGPIDMFDDPSFDRSRQLASEIAEYMRRHGPFEPHRLPSDEMEYTSLPGVLEKLGDR
FEDMD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaccattagtgtaattaaagcagacgttggaagcgtagcaggtcacgcagtc
gcacatgaggcattaaagaaaaagtgcgacgagatactggcagaagccagggatacagga
atccttgaggattattatattaccaactgtggagatgacattgacctcataatgacccac
agaaacggtgaagaaaatgaggaggttcaccagacagcatggaacgccttcagggaagcc
acagaggtggccaggggcttaaaactttacggtgcagggcaggacctcctctcagacaca
ttctcaggaaacatcaagggtatgggccctgggtgcgctgaaatggaatttaaggagagg
ccaagcgatcctgttataattttctgctgcgacaagacagaacctggagcgtttaacctg
cccctcttcagaatgtttgcagacccattcaacaccgcgggccttgttatcgatccaaca
cttcacaacggatacgaattcgaggtctttgatgttgttgaacacaaaaaggttacaatg
gcatgccctgatgagatgtacgacctcctcgccctcctgggttcaatcagccgctacgtg
ataaagaagatacacagaagggacgacggtgaaatagcagcctctgtgagcacagaaaga
ctgaacctcatggcaggaaagtacataggaaaggatgacccggtcgcaatcgtaagggca
cagtcaggattccctgcagcaggagaagtcgttgaacccttcgcattcccgcaccttgtg
ggtggctggatgaggggatcacacaacgggccactgatgcctgttgcccagagggatgca
acacccgtcaggttcgacggacctccaagggtaatagggctgggattccagatcgcagac
tgcaaactcgtgggcccaattgacatgtttgatgacccatcatttgatcgctcaaggcag
cttgcatctgaaattgcagagtacatgagaagacacgggccattcgaaccccacagactc
ccatcagatgaaatggagtacacatcccttccaggtgtgcttgaaaaactcggggacaga
tttgaggacatggattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system