KEGG   Methanothermobacter marburgensis: MTBMA_c03140Help
Entry
MTBMA_c03140      CDS       T01297                                 

Gene name
porA1
Definition
pyruvate synthase, subunit A (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTBMA_c03140 (porA1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c03140 (porA1)
   00020 Citrate cycle (TCA cycle)
    MTBMA_c03140 (porA1)
   00620 Pyruvate metabolism
    MTBMA_c03140 (porA1)
   00640 Propanoate metabolism
    MTBMA_c03140 (porA1)
   00650 Butanoate metabolism
    MTBMA_c03140 (porA1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTBMA_c03140 (porA1)
   00680 Methane metabolism
    MTBMA_c03140 (porA1)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MTBMA_c03140 (porA1)
Enzymes [BR:mmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MTBMA_c03140 (porA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(307631..308782)
Genome map
AA seq 383 aa AA seqDB search
MVLKVISANQAVAEAAKLAKPKVIPVYPITPQTSISEYLAKYVADGELDAEYIRVESEHS
AMSACVGASGAGVRVFTATSSQGLALMHEIVYAAAGLRNPIVMANANRALSAPLSIWNDQ
QDSIAERDSGWMQIYAESGQEALDSVLLSYRVSEDRDVLLPSMVCLDGFILTHTVEPVDI
PSQDEVDTFLPEFQPQAVLDPDEPMSLGTFTDPNYYMEARYEVERAMERSRKVIAKACQE
FSEMFRREYGFVEDYRCEDAEIILVAMGSVCSTLREVIDDMRDEGKPVGLLKVRIHRPFP
AEEIKKAVSNAHKIAVLDKNITFSVGGALHTELKALLPDKEVYGFIVGLGGRDITPEHIM
EIVRKTENPERTVSWIGLKEESQ
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggttcttaaggttatatccgcaaatcaggccgttgcagaagcagcaaaacttgcaaag
ccaaaggtcatccctgtttacccgataacaccccagacctcaatatcagagtaccttgca
aaatatgtggctgatggtgaactcgatgccgagtacataagggtcgagtcagagcacagc
gccatgagcgcatgcgtgggtgcatcaggtgcaggtgtgagggttttcacagcaacatca
tcccagggccttgcactcatgcatgagatagtatatgctgcagccggactcaggaacccc
attgtcatggcaaatgccaaccgtgccctatcagccccactcagtatatggaatgaccaa
caggattcgatagctgaaagggactctggatggatgcagatatacgcagaaagtgggcag
gaagcccttgactcagttctgctgtcctacagggtttcagaggacagggacgttctcctt
ccaagcatggtctgtctggatggtttcatactgacacacaccgtggaacccgtggacatc
ccatcacaggatgaggttgacacattcctgccagaattccagccacaggcagtacttgac
cctgacgaaccaatgtcactcggtacattcaccgatccaaactattacatggaggcacgc
tatgaggtagaaagggcaatggagaggtcaagaaaggttattgcaaaggcctgtcaggaa
ttcagtgaaatgttcaggcgagaatacggattcgttgaggattaccgctgcgaagatgct
gaaataatcctggtggccatgggctcagtctgcagcaccctgagagaggttattgatgat
atgagggatgaaggcaaacccgtggggctcctgaaggtgaggatacacaggccattccct
gctgaggagattaaaaaggcagtcagtaatgcccataagattgctgttctggataaaaat
ataactttcagtgttggtggtgctctccacaccgaattaaaggccctgctacccgacaag
gaggtttacgggttcattgtgggcctcggtggaagggacataacacctgaacacatcatg
gaaatcgtcagaaagacagaaaaccctgaaaggactgtcagctggatcggacttaaggag
gaatcacaatga

DBGET integrated database retrieval system