KEGG   Methanothermobacter marburgensis: MTBMA_c03150Help
Entry
MTBMA_c03150      CDS       T01297                                 

Gene name
porD
Definition
pyruvate synthase, subunit D (EC:1.2.7.1)
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTBMA_c03150 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c03150 (porD)
   00020 Citrate cycle (TCA cycle)
    MTBMA_c03150 (porD)
   00620 Pyruvate metabolism
    MTBMA_c03150 (porD)
   00640 Propanoate metabolism
    MTBMA_c03150 (porD)
   00650 Butanoate metabolism
    MTBMA_c03150 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTBMA_c03150 (porD)
   00680 Methane metabolism
    MTBMA_c03150 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MTBMA_c03150 (porD)
Enzymes [BR:mmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MTBMA_c03150 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(308795..309040)
Genome map
AA seq 81 aa AA seqDB search
MESLGATVKEPGSTRKNKTGSWRTFKPFLDKDKCIDCDNCILFCPEGCIDKEHEIDYDYC
KGCGICAEECPVKAIKMEREK
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggaatcacttggagcaaccgtcaaagaaccaggaagcacccgtaaaaacaagacgggg
agctggagaacattcaaaccattccttgataaggataaatgtatagactgtgataactgc
atccttttctgtcccgaaggctgcatagataaggagcatgagattgactacgattactgt
aagggatgcgggatatgcgcagaggaatgccctgttaaggcaattaagatggagagagaa
aaatag

DBGET integrated database retrieval system