KEGG   Methanothermobacter marburgensis: MTBMA_c03160Help
Entry
MTBMA_c03160      CDS       T01297                                 

Gene name
porC
Definition
(GenBank) pyruvate synthase, subunit C
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00010  Glycolysis / Gluconeogenesis
mmg00020  Citrate cycle (TCA cycle)
mmg00620  Pyruvate metabolism
mmg00633  Nitrotoluene degradation
mmg00640  Propanoate metabolism
mmg00650  Butanoate metabolism
mmg00680  Methane metabolism
mmg00720  Carbon fixation pathways in prokaryotes
mmg01100  Metabolic pathways
mmg01120  Microbial metabolism in diverse environments
mmg01130  Biosynthesis of antibiotics
mmg01200  Carbon metabolism
Module
mmg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mmg_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c03160 (porC)
   00020 Citrate cycle (TCA cycle)
    MTBMA_c03160 (porC)
   00620 Pyruvate metabolism
    MTBMA_c03160 (porC)
   00640 Propanoate metabolism
    MTBMA_c03160 (porC)
   00650 Butanoate metabolism
    MTBMA_c03160 (porC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MTBMA_c03160 (porC)
   00680 Methane metabolism
    MTBMA_c03160 (porC)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MTBMA_c03160 (porC)
Enzymes [BR:mmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MTBMA_c03160 (porC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR Torsin
Motif
Other DBs
NCBI-ProteinID: ADL57922
UniProt: P80902
Position
complement(309046..309579)
Genome map
AA seq 177 aa AA seqDB search
MIEIRFHGRGGQGAVTAAEILAKAAFEDGKYSQAFPFFGVERRGAPVMAFTRINDEPIRR
RYQVYNPDYVVVLDEGLVDVVDVFSGLKEDGVVLLNTAGTFTSENAKIHTIDATGIALEN
LGRPIVNTVMLGAFAGVTGLVSIDSLIKIIKETFPGKIGDKNAEAARIAYEKMKHSG
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattcgctttcatggacgcggtggccagggcgctgttacagcggcagagatt
ctagctaaagctgcctttgaagacggtaaatactcacaggcctttccattcttcggtgtt
gagcgtagaggcgctccagttatggctttcacacgaattaatgatgagcccatcaggaga
aggtatcaagtttacaatcccgattatgttgttgttctcgatgagggacttgttgatgtg
gttgacgtattttcaggcttaaaggaggatggtgtggttttactcaatactgcaggcacc
ttcacctcagagaacgccaagatccacaccattgacgccacaggcatagcccttgagaac
cttggaagaccaatcgttaacaccgtaatgctcggggcatttgcaggtgtaaccggtctt
gtaagcatagattcactcataaagattatcaaagaaacattccccgggaagattggggat
aaaaacgcagaggctgcaaggatagcctatgaaaaaatgaaacactcagggtga

DBGET integrated database retrieval system