KEGG   Methanothermobacter marburgensis: MTBMA_c04110Help
Entry
MTBMA_c04110      CDS       T01297                                 

Definition
ribokinase (EC:2.7.1.-)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MTBMA_c04110
Enzymes [BR:mmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MTBMA_c04110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
393871..394704
Genome map
AA seq 277 aa AA seqDB search
MSVVSVGTCNMDFIFRVPRFVEPDSEMNIEDLNVIPGGSAFNFAVWISHLGFKAGVVSSV
GRDVYGDMITSLLEFRGVDTSFISRQGEKTGMAFISVDDTGRRSIYSYMGANASLKIGEA
ESEYIMAADAVHLSGCYLEVASAVSGIRNVSFSPGTLLASYGIERLSGVLERTSIIFLND
DELEMLTGSGRSGIERLLEAGVGNVVVTHGPRGASFFSEDHSETLEIEAEDALDTTGAGD
AFAAGFMSMWLRGSEPAECLRNGHRVARRVISRIGAF
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttgtcagtgttggaacctgcaacatggattttatttttcgggtgccaagattc
gttgaaccagactctgagatgaacatagaagatttaaatgtcattccaggggggtccgcg
ttcaactttgccgtctggatctcccaccttggatttaaggccggggttgtgtcatcggtg
ggcagggatgtttacggggacatgataacatcccttctggaattcaggggagttgataca
tccttcatatcaaggcagggtgaaaaaactggtatggccttcatatcagtggatgatact
ggaaggaggtccatttactcctacatgggtgcaaacgccagtctaaagattggtgaggca
gaatcagaatatataatggctgcagatgcagttcatctcagcggctgctaccttgaggtt
gccagtgcggtttcaggtatcaggaacgtctccttcagcccaggcacactcctggcatca
tatggcattgaaaggctttcaggtgttcttgagagaaccagcataatattccttaatgat
gatgagcttgagatgctaaccggctccgggaggtcagggattgaaagacttcttgaggcc
ggggtcgggaacgttgttgtgacccatggacccagaggggcatccttcttttcagaggac
cactcagagaccctggaaattgaggctgaggatgcgctggataccactggggcaggggac
gcctttgcagcgggttttatgtcaatgtggcttagaggttcagagccagctgagtgcctg
agaaacggtcacagggtggcacgcagggtgatttcaaggattggcgcattttag

DBGET integrated database retrieval system