KEGG   Methanothermobacter marburgensis: MTBMA_c04490Help
Entry
MTBMA_c04490      CDS       T01297                                 

Gene name
hdrC
Definition
(GenBank) CoB-CoM heterodisulfide reductase, subunit C
  KO
K03390  heterodisulfide reductase subunit C2 [EC:1.8.7.3 1.8.98.4 1.8.98.5 1.8.98.6]
Organism
mmg  Methanothermobacter marburgensis
Pathway
mmg00680  Methane metabolism
mmg01100  Metabolic pathways
mmg01120  Microbial metabolism in diverse environments
mmg01200  Carbon metabolism
Module
mmg_M00357  Methanogenesis, acetate => methane
mmg_M00567  Methanogenesis, CO2 => methane
mmg_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MTBMA_c04490 (hdrC)
Enzymes [BR:mmg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.7  With an iron-sulfur protein as acceptor
    1.8.7.3  ferredoxin:CoB-CoM heterodisulfide reductase
     MTBMA_c04490 (hdrC)
   1.8.98  With other, known, physiological acceptors
    1.8.98.4  coenzyme F420:CoB-CoM heterodisulfide,ferredoxin reductase
     MTBMA_c04490 (hdrC)
    1.8.98.5  H2:CoB-CoM heterodisulfide,ferredoxin reductase
     MTBMA_c04490 (hdrC)
    1.8.98.6  formate:CoB-CoM heterodisulfide,ferredoxin reductase
     MTBMA_c04490 (hdrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_8 Fer4_17 Fer4_9 Fer4_10 Fer4_7 Fer4_4 Fer4 Fer4_2 Fer4_16 Fer4_20 Fer4_21 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADL58050
UniProt: Q50754
Position
427208..427765
Genome map
AA seq 185 aa AA seqDB search
MTLLQREENIIRKGNIDKEFSEKIKAAGGDSLEYCFQCGTCTGSCPSGRRTPYRVRQIIR
KANVGLKDEIISDPTLWMCTTCYSCQERCPRKVKIVDVVKLARNEAAKAGFMAPAHKAVG
SFVIKTGHGVPINDATMELRKAVGLGELPPTTHQFPEALEEVQKIIKATGFDQLIGYNWE
TGELE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaccctactgcagagagaagaaaacataatcagaaagggtaatattgacaaggaattc
tccgagaaaataaaggccgctggcggtgacagtctggaatactgtttccagtgcggtaca
tgcacaggatcctgcccatctggaagaagaaccccttacagggtaagacagataataagg
aaggcaaatgttggattaaaggatgaaataatctcagatccaaccctctggatgtgcaca
acatgttactcctgccaggaaaggtgcccacgtaaggtcaaaatcgtggatgtcgtgaaa
cttgcaaggaacgaagcagccaaagcaggattcatggcaccagcacacaaggcagttgga
tcattcgttataaaaacaggtcacggagtaccaatcaacgacgcaacaatggagctccga
aaggctgttggccttggagaactaccaccaacaacacaccagttccctgaggcacttgaa
gaggttcagaaaatcatcaaggcaacaggctttgaccagttaataggctacaactgggaa
acaggtgaacttgaataa

DBGET integrated database retrieval system