KEGG   Methanothermobacter marburgensis: MTBMA_c04490Help
Entry
MTBMA_c04490      CDS       T01297                                 

Gene name
hdrC
Definition
CoB-CoM heterodisulfide reductase, subunit C (EC:1.8.98.1)
Orthology
K03390  
heterodisulfide reductase subunit C [EC:1.8.98.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mmg01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mmg00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
427208..427765
Genome map
AA seq 185 aa AA seqDB search
MTLLQREENIIRKGNIDKEFSEKIKAAGGDSLEYCFQCGTCTGSCPSGRRTPYRVRQIIR
KANVGLKDEIISDPTLWMCTTCYSCQERCPRKVKIVDVVKLARNEAAKAGFMAPAHKAVG
SFVIKTGHGVPINDATMELRKAVGLGELPPTTHQFPEALEEVQKIIKATGFDQLIGYNWE
TGELE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaccctactgcagagagaagaaaacataatcagaaagggtaatattgacaaggaattc
tccgagaaaataaaggccgctggcggtgacagtctggaatactgtttccagtgcggtaca
tgcacaggatcctgcccatctggaagaagaaccccttacagggtaagacagataataagg
aaggcaaatgttggattaaaggatgaaataatctcagatccaaccctctggatgtgcaca
acatgttactcctgccaggaaaggtgcccacgtaaggtcaaaatcgtggatgtcgtgaaa
cttgcaaggaacgaagcagccaaagcaggattcatggcaccagcacacaaggcagttgga
tcattcgttataaaaacaggtcacggagtaccaatcaacgacgcaacaatggagctccga
aaggctgttggccttggagaactaccaccaacaacacaccagttccctgaggcacttgaa
gaggttcagaaaatcatcaaggcaacaggctttgaccagttaataggctacaactgggaa
acaggtgaacttgaataa

DBGET integrated database retrieval system