KEGG   Methanothermobacter marburgensis: MTBMA_c06740Help
Entry
MTBMA_c06740      CDS       T01297                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmg01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mmg00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
614025..615299
Genome map
AA seq 424 aa AA seqDB search
MRIIEFDHERVDELVERARIDVDEVLGPVADIISMVREGGDGALRELTEKFDGVSPESLT
VSQEEIEAAHKNLDPQVRKALTEAAGNIEEFHRLQMPSEWMAEIRPGVSAGQIVRPLDSV
GCYIPGGRAVYPSTILMTVIPARIAGVERIVCCTPPASDGSVPDAILVAADIAGAHEIYR
VGGAQAVAAMAYGTETIGAVDKIVGPGNIFVTAAKKLVYGDVDIDFPAGPSEVLIIADES
ADPEYIALEILAQAEHDPQAASVLVTDSEDLAASVDEKVRENIKYMERANIIGESLERYG
MIVLTEDIDGAVDFSNAYAPEHLVIMTDSPEKTLKGIRNAGSIFLGDLSPVAAGDYGSGT
NHVLPTSGCARMYSGLSTESFLKKPTVQMITREGLQNIQETVLRLAEYEGLYAHAESFRR
RLDR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaggataatagaatttgatcatgaaagagtcgatgagcttgttgagagagcgaggatt
gatgttgatgaggtcctggggccggtggcagatatcatctcaatggtgagagagggtggt
gatggggccctcagggaactcacagagaaatttgatggcgtctcacctgaaagcctcact
gtcagtcaggaagaaatagaggcggcccataaaaacctggacccacaggtcaggaaagcg
ctcactgaagctgcagggaacattgaggagttccacaggctccagatgccctctgagtgg
atggccgagatcagaccaggggtcagcgcagggcagatagtgcggccccttgacagtgtg
ggctgctacatacccggtggaagggccgtttacccatcaacaatactcatgaccgttata
ccggccaggatagcgggggttgaaaggatagtgtgctgcacacccccggcatccgatggc
tcggttcccgacgctatccttgtggcggccgacattgcaggtgcacatgagatataccgt
gtggggggcgcccaggcggtggctgcaatggcctacggtacagagacgatcggggcggtg
gataagattgtgggaccagggaacatatttgttaccgcagcaaagaaactggtatacggc
gacgtggacatagacttcccggcaggtccatcagaggtactcataattgcggatgaatct
gcagacccggagtacattgcccttgagatactggcacaggcagagcacgacccccaggct
gcaagtgtccttgtgacagactcggaggatcttgcagccagtgtggatgagaaggtacgt
gaaaatattaaatacatggaaagggccaatatcataggggagtcccttgaaagatacgga
atgatagttttaacggaggatattgacggggccgtggacttcagcaacgcctacgcccct
gagcaccttgttataatgacggattctcccgaaaaaacactcaagggtatccgtaacgca
ggatccatatttctgggtgacctctcacctgtggcggcaggggattacggttcagggacc
aaccacgtgctgccgacgtctggctgcgccaggatgtactctggactatcaacggagtcg
ttcctcaagaaaccaacggtgcagatgataaccagggaggggctccaaaacatccaggaa
accgtcctgcgtcttgctgaatacgagggcctctatgcccatgccgagtcattccgtagg
agacttgataggtga

DBGET integrated database retrieval system