KEGG   Methanothermobacter marburgensis: MTBMA_c07030Help
Entry
MTBMA_c07030      CDS       T01297                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MTBMA_c07030 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MTBMA_c07030 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MTBMA_c07030 (thrC)
Enzymes [BR:mmg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MTBMA_c07030 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
643514..644716
Genome map
AA seq 400 aa AA seqDB search
MIRCISCGKEYELNEIIYTCSECGSVLEVECEVEVSRDTFSCRRQNMWKYREFMPVDPSK
IVSLDEGGTPFVRCDNIGRKLGIELYVKVEGSNPTGSFKDRGMSVGITKAVELGVDTVGC
ASTGNTSASLAAYAARAGLGCVVLLPSGKVALGKLAQAMFHGAQVLSVRGNFDEALEAVT
ELALMGELYLLNSVNPFRLEGQKTIGFEIVDDLGWESPDRIILPVGNAGNISAIWKGISE
FHRAGFIDERPMMTGIQAEGAAPVVEAFRKGKMEIDPVKNPETVATAIRIGAPVSYLKAL
RAIYESDGYAETVTDEEILSAQKLLARREGIGVEPASAASIAGLLKLVDEGVIDRGERVV
CVVTGHVLKDPDTAIRASTEPVEVEPDIDQLRSVIRRKRT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
gtgataaggtgcatatcatgcggtaaggagtatgaactaaacgagatcatatacacctgc
agtgaatgcgggtcagtgctggaggttgaatgtgaagtcgaggtttcaagggacacattc
agctgcagaaggcagaacatgtggaagtacagggagttcatgcctgtggacccctcaaag
atagtgagcctcgatgagggtggaacaccctttgtgaggtgcgataacattggcaggaaa
ctcggcattgaactatacgtgaaggtggagggctccaaccccacaggtagcttcaaggac
aggggtatgagtgtcggtatcacaaaggcagttgaactgggcgttgatacggtgggctgt
gcctcaaccggcaatacctccgcttccctggcagcctacgcagcaagggctggtctcggt
tgcgtggtgctcctcccttcaggtaaggttgcccttggcaaacttgcacaggcaatgttc
catggtgcccaggttttatctgtcaggggaaacttcgatgaggcccttgaggcggtaacg
gaacttgccctcatgggggagctctacctcctcaactcggttaaccccttcaggcttgag
gggcagaagaccataggctttgagatagtggatgaccttggctgggagtccccggaccgc
atcatcctcccggttggtaacgcagggaacatatcagccatatggaagggtatctcagag
ttccacagggcagggttcattgatgagaggccaatgatgacgggtatacaggcagagggt
gctgcacctgtggttgaggctttcaggaagggtaagatggagattgaccctgttaagaac
cctgagacggttgcaaccgccataaggatcggggcgcctgtgagttacctcaaggcactg
agggccatctatgagtcagatggatatgccgagacagtgaccgatgaggagatactatct
gcccagaaactccttgccaggagggagggtataggtgttgaaccggcgtctgcagcatcc
atagcaggcctcctgaaactggtggatgagggtgtcattgacaggggtgaacgggtggtc
tgcgttgtaacaggtcacgtacttaaggatcctgacaccgccataagggcttcaacagaa
ccagttgaggtcgaacccgatatagaccagctaaggtccgttataaggagaaagaggacc
taa

DBGET integrated database retrieval system