KEGG   Methanothermobacter marburgensis: MTBMA_c08320Help
Entry
MTBMA_c08320      CDS       T01297                                 

Definition
(GenBank) predicted M42 aminopeptidase
Organism
mmg  Methanothermobacter marburgensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
751692..752714
Genome map
AA seq 340 aa AA seqDB search
MKELMKRLSLASGVSGFEGEVRDIIASELEGHVDKIEEDRLGNIIATRSGSGPSVMLAAH
MDEIGLMVRHIDKKGFIRFSKIGGISDQMILNQAVWIHGENGPVMGVIGSKPPHRMKAAE
RKKVTTHDNMFIDIGAESREDAEELVSVGDPITFHAPYSELPNSRFTGKALDNRIGCLVM
VEVLKRVDTDATVYGVGTVQEEVGLKGAKTSAFKLNPDMALALDVTIAGDHPGMKEEEAP
AKLDGGPAVILTDASGRGIITHPRVKDWLLETAGEEDIPVQIEVSEGGTTDATAIHLTRE
GIPAGVVSVPTRYIHTTVSMASMKDIEMTVDLLVKAIERL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaactcatgaagcgtctctcacttgccagcggagtctctggatttgagggagag
gtaagggatatcatagcatctgaacttgaaggtcatgttgataagatagaggaggacagg
cttggtaacatcatcgcaaccaggagtgggtccggtccatcggtcatgcttgcagcccac
atggatgaaataggcctcatggtgaggcacattgataagaagggcttcataaggttttca
aagatcgggggaatcagtgaccagatgatactcaaccaggctgtctggatccacggggag
aatggccctgtgatgggcgtcattggatccaagcccccccaccggatgaaggccgctgag
aggaagaaggtaacaacccatgataacatgttcatcgatataggggcagagtcccgtgag
gatgcagaggaacttgtctctgtgggggatcccattacattccatgcaccctacagtgaa
cttcccaattcccgattcacaggaaaggcccttgacaaccgtatagggtgccttgtgatg
gttgaggtccttaaaagggttgatactgatgcaacagtttacggtgttggaacggtccag
gaggaggtcgggctgaagggtgccaagacctcggccttcaagctcaaccctgacatggcc
cttgcccttgatgtcacaatagccggggatcacccaggtatgaaggaggaggaggcacca
gcgaagcttgacggtggccctgctgtcatcctcacagatgcgagtggtaggggtataata
acccatccaagggttaaggactggctccttgagaccgcaggggaggaggatataccggtg
cagatagaggtgagtgaggggggcacgaccgatgcaacagccattcaccttacaagggag
ggtatacctgcgggtgtggtctctgtacccacaaggtacatccacacaacggtgagcatg
gcaagcatgaaggacatcgagatgaccgttgaccttcttgttaaggcaattgaaagactt
taa

DBGET integrated database retrieval system