KEGG   Methanothermobacter marburgensis: MTBMA_c08320Help
Entry
MTBMA_c08320      CDS       T01297                                 

Definition
M42 aminopeptidase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MTBMA_c08320
Enzymes [BR:mmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MTBMA_c08320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
751692..752714
Genome map
AA seq 340 aa AA seqDB search
MKELMKRLSLASGVSGFEGEVRDIIASELEGHVDKIEEDRLGNIIATRSGSGPSVMLAAH
MDEIGLMVRHIDKKGFIRFSKIGGISDQMILNQAVWIHGENGPVMGVIGSKPPHRMKAAE
RKKVTTHDNMFIDIGAESREDAEELVSVGDPITFHAPYSELPNSRFTGKALDNRIGCLVM
VEVLKRVDTDATVYGVGTVQEEVGLKGAKTSAFKLNPDMALALDVTIAGDHPGMKEEEAP
AKLDGGPAVILTDASGRGIITHPRVKDWLLETAGEEDIPVQIEVSEGGTTDATAIHLTRE
GIPAGVVSVPTRYIHTTVSMASMKDIEMTVDLLVKAIERL
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaactcatgaagcgtctctcacttgccagcggagtctctggatttgagggagag
gtaagggatatcatagcatctgaacttgaaggtcatgttgataagatagaggaggacagg
cttggtaacatcatcgcaaccaggagtgggtccggtccatcggtcatgcttgcagcccac
atggatgaaataggcctcatggtgaggcacattgataagaagggcttcataaggttttca
aagatcgggggaatcagtgaccagatgatactcaaccaggctgtctggatccacggggag
aatggccctgtgatgggcgtcattggatccaagcccccccaccggatgaaggccgctgag
aggaagaaggtaacaacccatgataacatgttcatcgatataggggcagagtcccgtgag
gatgcagaggaacttgtctctgtgggggatcccattacattccatgcaccctacagtgaa
cttcccaattcccgattcacaggaaaggcccttgacaaccgtatagggtgccttgtgatg
gttgaggtccttaaaagggttgatactgatgcaacagtttacggtgttggaacggtccag
gaggaggtcgggctgaagggtgccaagacctcggccttcaagctcaaccctgacatggcc
cttgcccttgatgtcacaatagccggggatcacccaggtatgaaggaggaggaggcacca
gcgaagcttgacggtggccctgctgtcatcctcacagatgcgagtggtaggggtataata
acccatccaagggttaaggactggctccttgagaccgcaggggaggaggatataccggtg
cagatagaggtgagtgaggggggcacgaccgatgcaacagccattcaccttacaagggag
ggtatacctgcgggtgtggtctctgtacccacaaggtacatccacacaacggtgagcatg
gcaagcatgaaggacatcgagatgaccgttgaccttcttgttaaggcaattgaaagactt
taa

DBGET integrated database retrieval system