KEGG   Methanothermobacter marburgensis: MTBMA_c09440Help
Entry
MTBMA_c09440      CDS       T01297                                 

Definition
cobaltochelatase subunit-like protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTBMA_c09440
Enzymes [BR:mmg01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MTBMA_c09440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(887351..889342)
Genome map
AA seq 663 aa AA seqDB search
MKNLIFPFTAIVGQERVKKALILNAINPRIGGVLIKGDKGTGKTTAVRALADLLPSLRTV
KGCPFNCDPDEPEEACEVCRSGDLEVEYRKMRVVELPLGATEDRVVGSLDIGKALTEGIK
ALEPGILAEANRNILYVDEINLLDDHLVDVLLDAAAYGVNTVEREGISLQHPSRFILVGT
MNPAEGELRPQLSDRIGIHINVGTVTDIRQRILIMKRRDEFEDDPEGFVERFAESQRELR
ERIMEARKLLPAVTIDDDLLELIARVCVDAGVDGHRSDIAIVRTSKAIAAFNGRRRVREE
DVEDAIILVLGERIPGRTYNRENTRREMQRAREEMERERESESESGDSGSGPGEGEEDET
PAEGSPGEGSSGDSGASPSASSLGALAADVEGREPETQDMDVDIKRLLRIRGKKKERLYG
SRVESKTIKGRYVKSRFPRGSGDVAVDATLRAAASRGELKIEPGDIREKIRKHGARASIV
LVVDISGSMFSEKKAARVKGLIERFIEDAQRHKDRISVVGFRGRDAKVIIPSTARASSFR
DTVDSIRVGGTTPMAQGIKRGLEILREEKRHSEYVPFMVILSDGMPNVGVERNPKREAVE
AAARLREEDIPSAVINFEQGSRGGRDLNMEIALASGGSYYDLHDLEDPSMAVPRIMEHER
EMF
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaccttatttttccattcacagctatagttggacaggaaagggtgaaaaaggcc
cttatactcaatgcaataaatcccaggataggcggtgtactcataaagggtgataagggg
acaggtaaaacaaccgccgtgagggccctggcagaccttcttccatcactgcggacagtt
aagggctgccccttcaactgcgaccctgatgaacctgaagaggcatgtgaggtgtgccgt
tcaggtgacctggaggtggagtaccggaagatgcgggtggttgagctaccactgggtgca
acagaggaccgggttgtgggttcccttgacatagggaaggctctcacagagggtataaag
gcccttgagccgggtatacttgcagaggccaacaggaacatactctacgttgacgagata
aacctactggacgaccacctggtggatgtcctgcttgatgcggctgcctacggtgtgaac
acagttgagagggagggaatatcccttcagcacccatcaaggttcatcctggttgggacc
atgaaccccgctgagggcgaactccggccccagctctcagacaggataggtatacacata
aatgttggcacggtcaccgacatcaggcagagaatcctcataatgaagcggagggatgaa
ttcgaggatgaccctgagggattcgttgagaggttcgctgaaagtcagcgggaactcagg
gagaggataatggaggccaggaagctccttccagcggtcaccattgacgacgacctcctt
gagctgatagcaagggtctgtgtcgatgcaggggtcgatgggcacaggtccgatattgca
atcgtgaggacctcaaaggccatagcggccttcaacggcaggaggagggtccgtgaggag
gacgtcgaggatgcaataatactggttctgggggagagaatacctggaaggacctataac
cgtgaaaacacgagaagggagatgcagagggcccgtgaggagatggagcgtgaaagagag
tctgaatcagaaagtggtgactcaggaagtggcccaggtgagggtgaagaggatgaaacc
cctgcagagggttcaccgggggaaggtagcagtggagattcaggtgcttcaccttcggca
tcatccctgggggcccttgccgctgacgtggagggcagggaacctgaaacccaggacatg
gacgttgatataaagaggctcctcaggatcaggggtaagaagaaggagcgcctctacggt
tcaagggttgagtcgaagaccatcaagggcaggtacgtgaagagcaggttccccaggggc
tcaggtgacgttgctgttgacgccacactgagggccgccgcctcaaggggggaacttaaa
atagaacccggcgatataagggagaagatacgcaaacacggtgcaagggcatcaatcgtc
ctggtggtggatataagcgggtccatgttctctgagaagaaggccgccagggtcaagggc
ctcatagagaggttcatagaggacgcccagaggcataaggacaggataagtgttgtgggt
ttccgtggaagggacgcgaaggttataataccctcaacagcccgggcatcatcattcagg
gatacagtggacagtatacgggttggtggtacaacaccaatggcacagggcataaagagg
ggccttgagatactcagggaggagaagagacacagcgagtacgtcccgttcatggttatc
ctcagcgacggtatgccaaacgtgggggttgagaggaaccccaagagggaggcggttgaa
gcagcagccaggctcagggaggaggatataccctccgctgtcataaactttgagcagggc
tcaaggggtggaagggacctcaacatggagatagccctggcctcaggtggcagctactat
gacctccatgaccttgaggacccatccatggctgttccaaggataatggagcatgagagg
gagatgttctag

DBGET integrated database retrieval system