KEGG   Methanothermobacter marburgensis: MTBMA_c10160Help
Entry
MTBMA_c10160      CDS       T01297                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MTBMA_c10160 (galU)
   00052 Galactose metabolism
    MTBMA_c10160 (galU)
   00500 Starch and sucrose metabolism
    MTBMA_c10160 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MTBMA_c10160 (galU)
Enzymes [BR:mmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MTBMA_c10160 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(949913..950767)
Genome map
AA seq 284 aa AA seqDB search
MKAVIPAAGLGTRFLPATKAQPKEMLPVFDKPTIQYVVEEAVASGIDDILIITGKGKRSI
EDHFDRSFELEYFLRKNNKKEYLDEVEAISDLADIYFVRQKEQKGLGDAIYCARKHIDGE
EAFAVLLGDTITSSDVPCTRQLMDIYERYGASAIAVEEVPRDKVERYGIIDGREVSEGIY
SIDDMVEKPPISEAPSNLAIMGRYVLESEIFDHIENVPPGFGGEIQLTDAMRELKTVYGC
VFRGKTYDIGNRVDWLKTSLEFAMRDDEIRPELVDYMRGLISRY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagttataccagcagctggtcttgggacccgttttcttcccgcaaccaaggca
cagcccaaggagatgttaccggtatttgataaaccaacaatccagtacgttgtggaggag
gctgtggcttcaggcatagacgacatactcataataacaggtaagggtaagaggtcaatc
gaggaccactttgacaggtcatttgaacttgagtatttcctgaggaagaacaacaagaag
gagtaccttgacgaggttgaggccatctctgaccttgcagacatatactttgtgagacag
aaggagcagaaggggctgggggatgccatatactgtgcaagaaaacacatagatggtgag
gaagcatttgcggttctcctgggtgatacgataacgtcatctgatgtcccgtgcacccgt
cagctcatggatatatatgaaaggtacggtgcctctgccattgcagttgaggaggtccca
agggataaggttgaacggtacggtatcattgatggaagggaggtcagtgagggcatctac
agcatagatgatatggtcgaaaaaccccctatcagtgaggctccatcgaatcttgccata
atgggaaggtacgtacttgagagtgaaatatttgatcacatagagaacgttcccccggga
ttcgggggtgagatccagctgaccgatgccatgagggaacttaaaacagtttatggctgt
gttttcaggggtaaaacctatgatataggtaacagggtggactggcttaaaacgtccctt
gaatttgccatgagggatgatgagataagaccggaactggttgattacatgaggggtctc
atctccaggtactga

DBGET integrated database retrieval system