KEGG   Methanothermobacter marburgensis: MTBMA_c11660Help
Entry
MTBMA_c11660      CDS       T01297                                 

Gene name
pheT
Definition
phenylalanyl-tRNA synthetase, beta chain (EC:6.1.1.20)
Orthology
K01890  
phenylalanyl-tRNA synthetase beta chain [EC:6.1.1.20]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Aminoacyl-tRNA biosynthesis
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:mmg00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1080013..1081668
Genome map
AA seq 551 aa AA seqDB search
MPVITLDYDDLKELGIDIDRERLIEVLPMMGSDIEDFDDEGIKVEFFPNRPDLLSVEGVA
RSLRGFLGIETGMPSYDVPESDIEVTVDESVLNVRPHLGMAVIENVRFTDKKLKQVMEFQ
EDLHWVIGRDRKKVAIGIHDLDRVEPPFVYSGVEPEGVTFTPLESVCEMTPREILEEHPK
GVAYAHLLRDHERYPLITDKNGDVLSLPPIINGELTKLTTETERILVDVTGTDERAVNQA
LNIICTSFAESGGVIRSVTVRRPESELRLPDLTPKEMSVSVSTASHITGIELDAAEIKEL
LMKARMDASIVSPDEVLAVIPAYRVDILHEVDLVENIATQYCIGRIEPLIPEVATIAEED
NWNRADKFIRDVMVGLGFQEVMSLMLTSEESHYQKMRLEEDERVQVAQPISQDRTMIRKS
LLNGLLEFLEDNRHEDLPQRIFEVGDVVYIDPKAETRTRTVKKLACAITHSSAGFTEIKS
IAAAVVENLGYEFRVEPLDHPSFIRGRCASIESEGESSRIRGFFGEVHPEVVTNFNLEYP
VIALEIEFEEK
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttataacgttggattatgatgacctgaaggaactgggcattgacattgataga
gaaaggctcattgaagttctgccgatgatggggagtgacattgaggactttgatgatgag
ggtattaaggttgaattcttccccaaccgccctgacctcctctcggttgagggtgttgca
aggagcctcaggggatttctggggattgaaacaggcatgcccagttatgatgttcctgaa
tcagacattgaggtgactgttgatgagtctgtcctcaatgtgaggccccaccttggaatg
gctgtcattgaaaatgtgagattcacagataagaagcttaaacaggtcatggagtttcag
gaggacctccactgggttatcgggcgtgaccggaagaaggtggccattggtatacatgac
cttgaccgtgttgagccccccttcgtctacagtggagttgaacctgagggtgtcaccttc
accccccttgagagtgtatgtgaaatgacaccccgggagatactggaggagcaccccaag
ggtgtggcctacgcacatctcctgagggaccatgaacgttatcccctcataaccgataag
aatggagatgtgctctccctcccccccataataaacggggaactcaccaagttaaccaca
gagacagagaggatactcgttgatgttacagggaccgatgagagggcagttaaccaggcc
ctgaacatcatatgcacatcatttgcagagtctggtggtgtcataaggtcagtaacggtg
aggcgccctgaatctgagttaaggctccctgacctcacaccaaaggagatgagtgtctct
gtatcaacagcttcacacataacaggcattgaacttgacgctgctgagatcaaagaactc
ctcatgaaggcccgtatggatgcatccatcgtctcccctgacgaggtccttgcggttatc
ccggcctacagggtggacatcctccacgaggttgaccttgtggagaacatagcaacccag
tactgcatagggaggatcgaaccccttatccctgaagttgcaaccattgcagaggaggat
aactggaacagggccgataaattcataagggatgttatggtgggtctgggcttccaggag
gtgatgagcctcatgctgacaagtgaggagagccactaccagaagatgcgactcgaggag
gatgaaagggtgcaggttgcccagccgatttcacaggatcggaccatgatccgcaagagc
ctcctgaatggtctccttgaattccttgaggataacaggcatgaggacctcccccagaga
atattcgaggttggggacgtggtatacattgatcctaaagccgagacccgtacacgtacc
gtgaagaaactggcatgtgcaatcacccactcaagcgcgggtttcaccgagatcaagtca
attgcagctgcagtggttgagaaccttggatatgagttcagagtggaacccctcgaccac
ccatcattcataagggggaggtgtgcgtccattgaatctgagggtgaatcatcgagaata
agagggttcttcggtgaggttcaccccgaggttgtgacaaacttcaacctcgagtaccct
gtcattgcccttgaaattgaatttgaggagaagtga

DBGET integrated database retrieval system