KEGG   Methanothermobacter marburgensis: MTBMA_c12130Help
Entry
MTBMA_c12130      CDS       T01297                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmg  Methanothermobacter marburgensis
Brite
Enzymes [BR:mmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MTBMA_c12130
Transfer RNA biogenesis [BR:mmg03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MTBMA_c12130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1121190..1121756
Genome map
AA seq 188 aa AA seqDB search
MREACRRIIDDIISGQIKTRKDLERAKHRVCRDFGLEKFMSNSEILEHAAPEEKKLIENL
LRKKPTRTISGVAVVAVMCHPHECPHGRCLYCPESEKAPPSYTGEEPAALRARMYDFHPY
RQVYNRLEQLHSIGHPVDKVELIVMGGTFPSHSLCYQEWFISSCLEAMVDFGARLSGVKV
DMPNHQVM
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagggaagcttgtcgccggataatcgatgatataatatcaggtcaaataaaaacaagg
aaggaccttgaaagggctaaacacagggtttgccgtgactttggacttgaaaaattcatg
agtaactcagaaatccttgaacatgctgctccagaagaaaagaaattgatcgaaaatctc
ctcaggaaaaaacccaccaggacaatatcaggtgttgccgttgtggcagtcatgtgccac
ccccatgaatgcccccatggaaggtgcctgtactgccctgaaagtgaaaaggcacccccc
agctacacaggagaggaaccagccgccctgagggccagaatgtacgatttccacccctac
aggcaggtctacaatcgccttgagcagctccacagcataggccaccctgttgacaaggtg
gaactcatagtcatggggggcaccttcccgtcccacagcctctgctaccaggaatggttc
atatccagttgccttgaggccatggtggactttggagccaggctgagtggtgtcaaggtg
gatatgcccaatcaccaggttatgtga

DBGET integrated database retrieval system