KEGG   Methanothermobacter marburgensis: MTBMA_c12140Help
Entry
MTBMA_c12140      CDS       T01297                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmg  Methanothermobacter marburgensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1121759..1122805
Genome map
AA seq 348 aa AA seqDB search
MDDAQRFNETSPVRCVGMTFETRPDYCREEDVDRMLNLGVTRVELGVQTIYNYIYQRIRR
GHSIGDVIESNRILRDSGIKVAMHLMPGLFSDFDRDLRIFRRIFQDPSFRPDMLKIYPCL
VTRGSELYSLWENGLYKPYSTEEAVDLIVEIKKMMPPWVRTMRIQRDIPSQLIVDGVRKS
NLGELVYRRLEEEGVRCRCIRCREVGHMSRRGVSVDEDAVTVMVEEYDATGGREFFISAE
DPENDVLIGFLRLRFPSENAHRPEIDDKTALVRELHVYGSMIPIGERRDTIGQHRGYGEE
LLSRAEAIAYEGGMEKIMVTSGIGAREYYSKFGYRREGPYMSKELQED
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtggatgatgcccagcggttcaacgagacatcgccggttcgttgcgttgggatgacattt
gagacaaggcccgactactgccgggaggaggacgttgacagaatgctcaaccttggggtt
acaagggttgagctgggtgtccagaccatctacaactacatctaccagcgcatccggagg
ggccacagcataggggacgttatagaatccaacaggatactcagggactcggggataaag
gttgcgatgcacctcatgcccggcctcttctcagactttgaccgggacctccggatattc
aggaggatattccaggacccatccttcagacctgacatgctgaagatatacccctgcctt
gttaccaggggcagcgaactctacagcctctgggagaatggcctctataaaccatactcc
acagaggaggccgttgatctaatcgtcgagataaagaagatgatgcccccctgggtgagg
accatgaggatacagagggatataccctcccagcttatagttgatggtgtcagaaagtcc
aacctgggtgaactggtctacaggcgccttgaggaggagggtgtccgctgcaggtgcata
aggtgccgtgaggtgggccatatgagccgcaggggtgtaagtgttgatgaagatgcagtt
acagtgatggttgaggagtacgatgccacaggcggcagggagttcttcatctcagccgag
gaccctgaaaatgatgtcctcatcggattcctgaggctaaggttcccatcagaaaatgcc
caccgccctgaaatagatgataagaccgcccttgtgagggaactccatgtctacggttca
atgatacccataggtgagcgtcgcgataccattggacagcacaggggctacggtgaggag
ctactaagccgtgcggaggcaatagcatacgagggggggatggagaaaattatggtcaca
agcgggataggggcccgtgaatactacagcaaatttggctacagaagggagggcccctac
atgtcaaaagaacttcaggaggattaa

DBGET integrated database retrieval system