KEGG   Methanothermobacter marburgensis: MTBMA_c12630Help
Entry
MTBMA_c12630      CDS       T01297                                 

Gene name
speB
Definition
arginase/agmatinase/formimionoglutamate hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mmg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1166722..1167585)
Genome map
AA seq 287 aa AA seqDB search
MLLHTEDPLKFAFSTTDPERIPELSFGIVGVPFDSTTTYVPGTRFGPLAVREASYSFESY
NLRFSGEPGVKCFDFGDVDVVPGNFQRTAEFIGDSIGGLLDLDLKPITLGGEHTVTLPVI
GELISRDRAPVVIHLDAHMDMADRYAGERYSHATVMRRVHELGVDVIQIGVRSASAHEAE
FARENGIRCIMAHEVMQNPEAVSEALRGIRDPVYISVDMDVLDPAYAPSVGNPTPCGLTP
WVLEDMAEVLSRKDVVGFDVVEVASTGFGDQTSVNAAKIIYDLLTLL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcttttacatacagaagaccccctaaaatttgctttttcaacaacggaccctgagagg
atacctgaactttcatttggaatagtgggggtcccctttgattccacaaccacctatgtt
ccagggacacgcttcggacccctggcagttagggaggcatcctacagctttgaatcatat
aacctaaggttttcaggagagccaggtgttaaatgctttgacttcggtgacgtggatgtg
gtgccgggtaatttccagagaaccgcggagttcataggtgactccataggcggattgctg
gacctggacctcaaacccatcaccctgggcggtgaacacacggttacactacccgtgatc
ggggaactcatatcccgcgacagagcgcctgtggttatccacctcgacgcccatatggat
atggcggatcgctatgcaggcgagaggtactcccatgcaacagtcatgaggcgcgttcat
gaacttggggtagatgtcattcagatcggggttcgctcagcatcagcccatgaggctgaa
tttgcaagggagaatggtataagatgcataatggcccatgaggtaatgcagaaccctgag
gctgtatctgaagccctcaggggtatcagggaccctgtatatatctcggttgacatggat
gtgcttgaccctgcatatgcaccatcggttggtaaccccacaccctgcggtctcacgcca
tgggttctcgaggacatggctgaagttctctccaggaaggatgtggttggttttgatgtg
gtggaggttgcatcaaccggctttggggatcagacatctgtgaatgcggccaagataatt
tatgaccttctgacacttttataa

DBGET integrated database retrieval system