KEGG   Methanothermobacter marburgensis: MTBMA_c14280Help
Entry
MTBMA_c14280      CDS       T01297                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTBMA_c14280 (tpi)
   01230 Biosynthesis of amino acids
    MTBMA_c14280 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c14280 (tpi)
   00051 Fructose and mannose metabolism
    MTBMA_c14280 (tpi)
   00562 Inositol phosphate metabolism
    MTBMA_c14280 (tpi)
Enzymes [BR:mmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MTBMA_c14280 (tpi)
Exosome [BR:mmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MTBMA_c14280 (tpi)
  Exosomal proteins of bladder cancer cells
   MTBMA_c14280 (tpi)
  Exosomal proteins of melanoma cells
   MTBMA_c14280 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1315262..1315930
Genome map
AA seq 222 aa AA seqDB search
METPIVILNFKTYTESTGKRALELAGACQEVADETGVNIAVAPQHMDLQPVAEAVDIPVL
AQHIDPIDAGGHTGGVLAECALEAGAAGTLINHSEKRMKLADIENVISRTRKLNMASVVC
TNNVSTTAAAAALKPDFVAVEPPELIGSGIPVSKAEPEVITGSVSAVQDINPDVSVLCGA
GISTGEDMRAALDLGAEGVLLASGIILAESPRDALLDLVSKV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacctatcgtcatactgaattttaagacctacactgagtccacaggtaaaaga
gcccttgaacttgcaggtgcctgtcaggaggttgcagatgaaacaggcgttaacatcgca
gtggcgccccagcacatggacctccagccggtggctgaggccgtggatatacctgtactg
gcccagcacatcgaccccatagatgccggagggcacacaggaggcgtccttgcagaatgt
gccctggaggcaggggcggcgggtaccctcataaaccactcagagaagaggatgaagctt
gcagacattgaaaatgtcatatcaaggacaaggaaacttaacatggcctcagtcgtatgc
accaacaatgtgagcaccacagcggccgcagcagcacttaaaccagatttcgtggctgtt
gaaccccctgaactcatagggtcaggcatacctgtttcaaaggcagaaccagaggttata
acaggaagcgtcagtgcggtgcaggatataaaccctgatgtcagcgtcctctgtggtgct
ggaatatccaccggtgaggatatgagggctgccctcgaccttggggccgagggtgttctt
cttgcctcgggcatcatactggcagaaagcccaagggacgcactcctggaccttgtaagc
aaagtgtga

DBGET integrated database retrieval system