KEGG   Methanothermobacter marburgensis: MTBMA_c14280Help
Entry
MTBMA_c14280      CDS       T01297                                 

Gene name
tpi
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MTBMA_c14280 (tpi)
   01230 Biosynthesis of amino acids
    MTBMA_c14280 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MTBMA_c14280 (tpi)
   00051 Fructose and mannose metabolism
    MTBMA_c14280 (tpi)
   00562 Inositol phosphate metabolism
    MTBMA_c14280 (tpi)
Enzymes [BR:mmg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MTBMA_c14280 (tpi)
Exosome [BR:mmg04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MTBMA_c14280 (tpi)
  Exosomal proteins of bladder cancer cells
   MTBMA_c14280 (tpi)
  Exosomal proteins of melanoma cells
   MTBMA_c14280 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1315262..1315930
Genome map
AA seq 222 aa AA seqDB search
METPIVILNFKTYTESTGKRALELAGACQEVADETGVNIAVAPQHMDLQPVAEAVDIPVL
AQHIDPIDAGGHTGGVLAECALEAGAAGTLINHSEKRMKLADIENVISRTRKLNMASVVC
TNNVSTTAAAAALKPDFVAVEPPELIGSGIPVSKAEPEVITGSVSAVQDINPDVSVLCGA
GISTGEDMRAALDLGAEGVLLASGIILAESPRDALLDLVSKV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacctatcgtcatactgaattttaagacctacactgagtccacaggtaaaaga
gcccttgaacttgcaggtgcctgtcaggaggttgcagatgaaacaggcgttaacatcgca
gtggcgccccagcacatggacctccagccggtggctgaggccgtggatatacctgtactg
gcccagcacatcgaccccatagatgccggagggcacacaggaggcgtccttgcagaatgt
gccctggaggcaggggcggcgggtaccctcataaaccactcagagaagaggatgaagctt
gcagacattgaaaatgtcatatcaaggacaaggaaacttaacatggcctcagtcgtatgc
accaacaatgtgagcaccacagcggccgcagcagcacttaaaccagatttcgtggctgtt
gaaccccctgaactcatagggtcaggcatacctgtttcaaaggcagaaccagaggttata
acaggaagcgtcagtgcggtgcaggatataaaccctgatgtcagcgtcctctgtggtgct
ggaatatccaccggtgaggatatgagggctgccctcgaccttggggccgagggtgttctt
cttgcctcgggcatcatactggcagaaagcccaagggacgcactcctggaccttgtaagc
aaagtgtga

DBGET integrated database retrieval system