KEGG   Methanothermobacter marburgensis: MTBMA_c17260Help
Entry
MTBMA_c17260      CDS       T01297                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase-related protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MTBMA_c17260
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MTBMA_c17260
Enzymes [BR:mmg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MTBMA_c17260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1564511..1564777)
Genome map
AA seq 88 aa AA seqDB search
MEWLNWLYDYRRDSPTYGIINEIFMGERYPRAVYIPPGIFHGTKNIGTDIAVVIGMPSLL
YDPENVDERRLDPNDNDLIPYEWGCKME
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggaatggttaaactggctctatgactaccgcagggattcacccacctatggtataata
aatgaaatctttatgggcgaaagatacccaagagctgtttacatacctcccgggatattt
catggaacaaagaatattggtacagatattgctgtggtcataggcatgccgtcccttcta
tatgatcctgaaaacgttgatgaaagacggctggaccctaatgataatgacttgataccc
tatgaatggggctgtaaaatggaatag

DBGET integrated database retrieval system