KEGG   Methanothermobacter marburgensis: MTBMA_c17930Help
Entry
MTBMA_c17930      CDS       T01297                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mmg00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1630574..1631137
Genome map
AA seq 187 aa AA seqDB search
MNPLRDVVDVSVHLYRRGLVSGIGGNVSARVDDRVFITPTMVPLDQVTLKNVAMVDLEGN
ILRGGRPSSELELHLEVYRRRPDVNGVVHTHSPYARAFLVAGIEIEKMEGFRGLGQGNLP
VVSYYPPGSRDLASACAETMVNENAAVLENHGVVCAGETVKEALLLAEFIEELAKTRFIA
EVLKFMK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgaatccattgagggatgttgttgatgtttcggtccacctctacaggaggggtcttgta
tctggcattggaggaaacgtgagtgcaagggtggatgatagggttttcataacacccaca
atggtcccccttgaccaggtgacacttaagaatgttgcaatggttgaccttgaagggaat
atcctcaggggcggaagaccatcctcggaactggaactccatcttgaggtctacaggagg
aggcctgatgtcaatggtgtggtgcacacccactcaccatatgccagggcatttttagtt
gccgggattgagattgagaaaatggagggcttcaggggactcggacagggaaatcttcct
gtagtatcatattatccccctggaagcagggaccttgcatcagcctgtgcagagacgatg
gtgaatgaaaatgcggctgtccttgaaaaccacggtgtggtatgtgcaggtgaaactgtt
aaggaagccctcctgcttgcagagttcattgaggagctggcaaaaacccggttcattgct
gaggtcctgaaattcatgaaatag

DBGET integrated database retrieval system