KEGG   Methanothermobacter marburgensis: MTBMA_c17930Help
Entry
MTBMA_c17930      CDS       T01297                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MTBMA_c17930
Enzymes [BR:mmg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MTBMA_c17930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1630574..1631137
Genome map
AA seq 187 aa AA seqDB search
MNPLRDVVDVSVHLYRRGLVSGIGGNVSARVDDRVFITPTMVPLDQVTLKNVAMVDLEGN
ILRGGRPSSELELHLEVYRRRPDVNGVVHTHSPYARAFLVAGIEIEKMEGFRGLGQGNLP
VVSYYPPGSRDLASACAETMVNENAAVLENHGVVCAGETVKEALLLAEFIEELAKTRFIA
EVLKFMK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgaatccattgagggatgttgttgatgtttcggtccacctctacaggaggggtcttgta
tctggcattggaggaaacgtgagtgcaagggtggatgatagggttttcataacacccaca
atggtcccccttgaccaggtgacacttaagaatgttgcaatggttgaccttgaagggaat
atcctcaggggcggaagaccatcctcggaactggaactccatcttgaggtctacaggagg
aggcctgatgtcaatggtgtggtgcacacccactcaccatatgccagggcatttttagtt
gccgggattgagattgagaaaatggagggcttcaggggactcggacagggaaatcttcct
gtagtatcatattatccccctggaagcagggaccttgcatcagcctgtgcagagacgatg
gtgaatgaaaatgcggctgtccttgaaaaccacggtgtggtatgtgcaggtgaaactgtt
aaggaagccctcctgcttgcagagttcattgaggagctggcaaaaacccggttcattgct
gaggtcctgaaattcatgaaatag

DBGET integrated database retrieval system