KEGG   Methanothermobacter marburgensis: MTBMA_c17950Help
Entry
MTBMA_c17950      CDS       T01297                                 

Gene name
cbiG
Definition
cobalamin biosynthesis protein
Orthology
K02189  
cobalt-precorrin 5A hydrolase [EC:3.7.1.12]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mmg00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1631555..1632544)
Genome map
AA seq 329 aa AA seqDB search
MRVSILTLTENGRKLGESLKTGLKDDPTILSVETLHRDIDFREVFSRSDMIIGIMAAGIM
VRKIAPLLENKFSDPGVIVIDEMGRNVISLLSGHAGGANDFAVKIADILNANPVITTATD
VNGLVGIDSFAARYFYVILDRHLVKHFNSSIVEGHTVELHSSRNLGPLIDGELSRTYRYM
MDGDEIVRAQCNSEVMRLAPLKVSVGIGTRRGVESSRVTGAIVEALGLLKLPPERIDALA
TGYMKKNERGIIDAAEDLGVPLEIIPLQELKAQDTHSFSDFVNEKFGVGSVCEAAALKSA
GTGSRLVIRKTTSSGVAVAVAVSGTPKTF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgagtatactgacactcacagaaaatggcaggaaacttggtgagagcctgaag
acaggtcttaaggacgatcccaccattctctcagttgaaaccctgcacagggatatagat
ttcagggaggtgttttccagaagcgacatgataattggtataatggcagcaggtataatg
gtgagaaagatcgccccgcttcttgaaaacaaattctctgatccaggagttattgtcatc
gacgaaatgggaaggaatgtcataagtctcctttcgggacatgcaggaggtgcaaacgat
tttgcagtcaaaattgcagacatactcaacgcaaaccccgttataacaacagcaactgat
gttaatggtcttgtgggaattgacagctttgcagcaagatacttctacgtgatacttgac
aggcacctcgtgaagcacttcaattcctcaattgtggaggggcacactgtggaactgcac
tcatcaaggaacctggggcccctcattgatggtgaactgtccagaacctacaggtacatg
atggatggagatgagattgtaagggcccagtgtaactctgaggtcatgagactggctccc
ctcaaggtttcagtgggtatagggacaaggaggggagttgagtccagccgggtaaccggt
gcaattgtggaagcacttggactcttgaagctaccccccgagaggatcgatgcactggca
acaggttacatgaagaaaaatgaaaggggaataattgatgcagcagaggatctgggggtc
cccctggaaatcatacctctgcaggagctcaaagcacaggatacacactcattttcagat
tttgtcaacgaaaaatttggtgttggaagtgtatgcgaagccgcggctcttaaaagtgca
ggaaccggatcaagacttgttataagaaaaacaacgtcatcaggagttgcggttgcagtg
gcggtttcagggacaccaaaaactttttaa

DBGET integrated database retrieval system