KEGG   Methanothermobacter marburgensis: MTBMA_c17950Help
Entry
MTBMA_c17950      CDS       T01297                                 

Gene name
cbiG
Definition
cobalamin biosynthesis protein
Orthology
K02189  
cobalt-precorrin 5A hydrolase [EC:3.7.1.12]
Organism
mmg  Methanothermobacter marburgensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MTBMA_c17950 (cbiG)
Enzymes [BR:mmg01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.12  cobalt-precorrin 5A hydrolase
     MTBMA_c17950 (cbiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1631555..1632544)
Genome map
AA seq 329 aa AA seqDB search
MRVSILTLTENGRKLGESLKTGLKDDPTILSVETLHRDIDFREVFSRSDMIIGIMAAGIM
VRKIAPLLENKFSDPGVIVIDEMGRNVISLLSGHAGGANDFAVKIADILNANPVITTATD
VNGLVGIDSFAARYFYVILDRHLVKHFNSSIVEGHTVELHSSRNLGPLIDGELSRTYRYM
MDGDEIVRAQCNSEVMRLAPLKVSVGIGTRRGVESSRVTGAIVEALGLLKLPPERIDALA
TGYMKKNERGIIDAAEDLGVPLEIIPLQELKAQDTHSFSDFVNEKFGVGSVCEAAALKSA
GTGSRLVIRKTTSSGVAVAVAVSGTPKTF
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgagtatactgacactcacagaaaatggcaggaaacttggtgagagcctgaag
acaggtcttaaggacgatcccaccattctctcagttgaaaccctgcacagggatatagat
ttcagggaggtgttttccagaagcgacatgataattggtataatggcagcaggtataatg
gtgagaaagatcgccccgcttcttgaaaacaaattctctgatccaggagttattgtcatc
gacgaaatgggaaggaatgtcataagtctcctttcgggacatgcaggaggtgcaaacgat
tttgcagtcaaaattgcagacatactcaacgcaaaccccgttataacaacagcaactgat
gttaatggtcttgtgggaattgacagctttgcagcaagatacttctacgtgatacttgac
aggcacctcgtgaagcacttcaattcctcaattgtggaggggcacactgtggaactgcac
tcatcaaggaacctggggcccctcattgatggtgaactgtccagaacctacaggtacatg
atggatggagatgagattgtaagggcccagtgtaactctgaggtcatgagactggctccc
ctcaaggtttcagtgggtatagggacaaggaggggagttgagtccagccgggtaaccggt
gcaattgtggaagcacttggactcttgaagctaccccccgagaggatcgatgcactggca
acaggttacatgaagaaaaatgaaaggggaataattgatgcagcagaggatctgggggtc
cccctggaaatcatacctctgcaggagctcaaagcacaggatacacactcattttcagat
tttgtcaacgaaaaatttggtgttggaagtgtatgcgaagccgcggctcttaaaagtgca
ggaaccggatcaagacttgttataagaaaaacaacgtcatcaggagttgcggttgcagtg
gcggtttcagggacaccaaaaactttttaa

DBGET integrated database retrieval system