KEGG   Methanohalophilus mahii: Mmah_0120Help
Entry
Mmah_0120         CDS       T01211                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmh  Methanohalophilus mahii
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mmah_0120
   00052 Galactose metabolism
    Mmah_0120
   00500 Starch and sucrose metabolism
    Mmah_0120
   00520 Amino sugar and nucleotide sugar metabolism
    Mmah_0120
Enzymes [BR:mmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mmah_0120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
150044..150919
Genome map
AA seq 291 aa AA seqDB search
MDVKKAVIPVAGLGTRFLPVTKSMPKEMLPIIDTPVIHYVVQEAIESGIDDIIFVTGRNK
RAIEDYFDGCPELEMHLKNRGKYDMLEMVQEISSMVDIHYIRQKEPNGLGDAIMTARKHV
SGDPFAVLLGDDIIVNEKPCTRQLIDVFRKYGRSTIAVEEVPQDKVSSYGIISGSPVDEY
LYALDDIVEKPSVEEAPSNIGAIGRYVFTPEIFDCIEQTSKGVGGEIQLTDGIRLLNDSQ
KVYAHQFTGRRYDSGNKVEYVKAVLDFAMKDDGMREEIQQHLQNLGPITHD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaaaaaaggccgtaataccggtggcgggactggggactcgtttcttaccggta
acaaaatcaatgcccaaagagatgttgccgataatagatacacctgtgattcattatgtg
gtacaggaagccatcgaatccgggatcgatgatatcatatttgtaaccgggcgcaataag
cgggcgatcgaggattattttgacggttgcccggaactggagatgcatcttaagaatcgg
ggtaagtatgatatgctggagatggtgcaggagatctcctcaatggtggatatccattac
atccgccagaaggaacccaacgggctgggcgatgccatcatgaccgcccgcaaacatgtc
agcggggatccttttgcagtgcttctgggtgatgatattattgtcaacgagaaaccctgt
acccgtcagttaatcgacgtcttccggaaatacggccgctccacgatcgcggtggaggaa
gtgccacaggataaggtcagcagttacgggatcataagcggcagtcctgtggatgaatat
ctgtatgccctggatgatatcgtggaaaaaccctctgtggaagaggctccttccaatatc
ggggccatcgggcggtacgttttcactccggagatattcgattgcattgagcagacatcc
aaaggtgtgggtggcgagatccagctgaccgacgggatacggctgctcaacgattcacag
aaagtctatgcccaccagttcaccggcaggaggtatgattccggtaacaaggtggagtat
gtgaaggcagttctggattttgccatgaaggatgatgggatgagggaagagatccagcag
catttgcagaatctggggccaatcacccacgactga

DBGET integrated database retrieval system